KEGG   Phascolarctos cinereus (koala): 110201193
Entry
110201193         CDS       T05867                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A-like isoform X1
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04110  Cell cycle
pcw04115  p53 signaling pathway
pcw04218  Cellular senescence
pcw04934  Cushing syndrome
pcw05163  Human cytomegalovirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05206  MicroRNAs in cancer
pcw05212  Pancreatic cancer
pcw05214  Glioma
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110201193
   04115 p53 signaling pathway
    110201193
   04218 Cellular senescence
    110201193
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110201193
   05206 MicroRNAs in cancer
    110201193
   05203 Viral carcinogenesis
    110201193
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110201193
   05225 Hepatocellular carcinoma
    110201193
   05214 Glioma
    110201193
   05220 Chronic myeloid leukemia
    110201193
   05218 Melanoma
    110201193
   05219 Bladder cancer
    110201193
   05223 Non-small cell lung cancer
    110201193
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110201193
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110201193
   05163 Human cytomegalovirus infection
    110201193
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110201193
   01522 Endocrine resistance
    110201193
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 110201193
NCBI-ProteinID: XP_020832354
UniProt: A0A6P5JMU2
LinkDB
Position
Unknown
AA seq 148 aa
MHRRHNSEKSMKPSVERLTEAAAMGRTEVVRELLESGTDPNIVNRFGRSAIQVMMMGSVR
VAELLLQHGAEPNTPDPTTLTLPVHDAAREGFLDTLMLLHRAGARLDLKDALGRLPLDLA
EEQGHHLVITYLREVVKGGTKSTPQDVE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgcacagaaggcacaattcagagaaaagcatgaaaccgtccgtagaaagactaacagaa
gctgctgctatgggtcggactgaggtagtaagggagctccttgaatcaggcactgatccc
aatatcgtgaaccgctttggccggagcgccattcaggtcatgatgatgggcagtgtgcgc
gtggcagagctcctgctgcagcacggagcagagcccaacactccagacccaacaaccctc
actctaccagtccacgacgctgcccgggagggcttcctggacactctgatgctgcttcac
cgggcaggggcacggctggacctcaaggacgccctgggtcgcctccccttggacctagct
gaggaacagggacaccacctcgtgatcacatacctgcgcgaggtggtgaagggaggaacg
aaatccaccccccaggatgtagaatag

DBGET integrated database retrieval system