KEGG   Phascolarctos cinereus (koala): 110201877
Entry
110201877         CDS       T05867                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interferon-inducible protein AIM2-like
  KO
K12966  absent in melanoma 2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04621  NOD-like receptor signaling pathway
pcw04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110201877
   04623 Cytosolic DNA-sensing pathway
    110201877
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon
Other DBs
NCBI-GeneID: 110201877
NCBI-ProteinID: XP_020833406
UniProt: A0A6P5JQ81
LinkDB
Position
Unknown
AA seq 392 aa
MSSRRNPTDVMKSHFSKILLDAFEKINDEHFKKCKFFLTVRKYITKKQYKADRTDLAHHM
IQVFGVLSALNKIIEVFKDMNLHEAVQALQKQKDKVEKKYNKKKEKKPVTRNNQAQMRRP
AFKSNNIGNPQLTKKNNLKLTNESKKNRAAKKRKATTEERQDSKKMKTSQEFSQKTEPEA
GREECAQTTSMVVKVLKVTQTFEYYTFAEKKEMFHATVANECEFIRVKVFNMSVKKHFNK
NKVIEISKGYWRKGFLEINKCSKVQDVCTNKEITVPKNIKRRAGKTTKIQMLQKQKQGSY
VDGVYEINKKTESEKCTFFEVKDNTGKIEVVMFGKWAKIKCEIGDKLRLTCFELSSWKKV
QLKSVTHSYVQVIKPKKNEKSQERPTPSLPDN
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcatcgagacgaaatccaactgatgtgatgaagagtcatttttcaaaaattttgcta
gacgcatttgaaaagataaatgatgaacactttaaaaaatgtaaattttttctaacggtt
agaaaatacataaccaagaagcaatacaaagctgatcgaactgacttagctcaccatatg
atacaagtgtttggtgttctctctgctctgaacaagatcattgaagtgttcaaggacatg
aaccttcatgaagctgttcaggcccttcaaaaacaaaaagacaaagttgagaagaaatac
aataagaaaaaagagaagaaaccagtgacaagaaacaatcaggctcaaatgagaagacca
gctttcaaaagcaacaatattggtaaccctcaactgaccaagaaaaataacctgaaactc
accaatgagtcaaagaagaatcgtgctgctaagaaaagaaaagcaacaactgaagagagg
caagacagtaagaaaatgaagacatcccaggaattctctcagaaaacagaaccagaagct
ggaagagaagagtgtgcccagacaacatctatggtagtgaaggtgctcaaagtgacccag
acatttgagtattatacctttgcagagaagaaagagatgtttcatgctactgtggcaaat
gagtgtgaatttatccgagtgaaggttttcaacatgagtgtcaagaaacacttcaacaaa
aataaggtcattgagatatcaaaaggttattggagaaaaggtttcctggaaataaacaaa
tgctccaaggtgcaagatgtgtgtactaacaaagagatcacagtacccaaaaacattaaa
agaagagcaggtaaaaccacaaaaatccaaatgcttcaaaaacaaaaacaaggaagctat
gtggatggtgtctatgagatcaataagaaaactgaatcggagaaatgtacattctttgaa
gtgaaggacaacacaggaaaaattgaagtggtgatgtttggcaaatgggccaaaataaag
tgtgagataggagacaaacttcgactcacctgctttgagttatcttcttggaagaaagtg
caactgaaatctgtaactcatagttatgtccaggtcatcaagcctaagaaaaatgagaaa
agtcaagagagaccaactccctcccttcctgacaactga

DBGET integrated database retrieval system