KEGG   Phascolarctos cinereus (koala): 110202713
Entry
110202713         CDS       T05867                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04022  cGMP-PKG signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04152  AMPK signaling pathway
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04213  Longevity regulating pathway - multiple species
pcw04218  Cellular senescence
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04370  VEGF signaling pathway
pcw04371  Apelin signaling pathway
pcw04380  Osteoclast differentiation
pcw04510  Focal adhesion
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04611  Platelet activation
pcw04613  Neutrophil extracellular trap formation
pcw04620  Toll-like receptor signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04668  TNF signaling pathway
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04728  Dopaminergic synapse
pcw04910  Insulin signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04915  Estrogen signaling pathway
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04922  Glucagon signaling pathway
pcw04923  Regulation of lipolysis in adipocytes
pcw04926  Relaxin signaling pathway
pcw04929  GnRH secretion
pcw04931  Insulin resistance
pcw04932  Non-alcoholic fatty liver disease
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw04973  Carbohydrate digestion and absorption
pcw05010  Alzheimer disease
pcw05017  Spinocerebellar ataxia
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05142  Chagas disease
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110202713 (AKT2)
   04012 ErbB signaling pathway
    110202713 (AKT2)
   04014 Ras signaling pathway
    110202713 (AKT2)
   04015 Rap1 signaling pathway
    110202713 (AKT2)
   04370 VEGF signaling pathway
    110202713 (AKT2)
   04371 Apelin signaling pathway
    110202713 (AKT2)
   04630 JAK-STAT signaling pathway
    110202713 (AKT2)
   04668 TNF signaling pathway
    110202713 (AKT2)
   04066 HIF-1 signaling pathway
    110202713 (AKT2)
   04068 FoxO signaling pathway
    110202713 (AKT2)
   04072 Phospholipase D signaling pathway
    110202713 (AKT2)
   04071 Sphingolipid signaling pathway
    110202713 (AKT2)
   04024 cAMP signaling pathway
    110202713 (AKT2)
   04022 cGMP-PKG signaling pathway
    110202713 (AKT2)
   04151 PI3K-Akt signaling pathway
    110202713 (AKT2)
   04152 AMPK signaling pathway
    110202713 (AKT2)
   04150 mTOR signaling pathway
    110202713 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110202713 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    110202713 (AKT2)
   04218 Cellular senescence
    110202713 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110202713 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110202713 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110202713 (AKT2)
   04613 Neutrophil extracellular trap formation
    110202713 (AKT2)
   04620 Toll-like receptor signaling pathway
    110202713 (AKT2)
   04625 C-type lectin receptor signaling pathway
    110202713 (AKT2)
   04660 T cell receptor signaling pathway
    110202713 (AKT2)
   04662 B cell receptor signaling pathway
    110202713 (AKT2)
   04664 Fc epsilon RI signaling pathway
    110202713 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    110202713 (AKT2)
   04062 Chemokine signaling pathway
    110202713 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110202713 (AKT2)
   04922 Glucagon signaling pathway
    110202713 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    110202713 (AKT2)
   04920 Adipocytokine signaling pathway
    110202713 (AKT2)
   04929 GnRH secretion
    110202713 (AKT2)
   04915 Estrogen signaling pathway
    110202713 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    110202713 (AKT2)
   04917 Prolactin signaling pathway
    110202713 (AKT2)
   04926 Relaxin signaling pathway
    110202713 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    110202713 (AKT2)
   04919 Thyroid hormone signaling pathway
    110202713 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110202713 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110202713 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    110202713 (AKT2)
   04728 Dopaminergic synapse
    110202713 (AKT2)
   04722 Neurotrophin signaling pathway
    110202713 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110202713 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    110202713 (AKT2)
   04213 Longevity regulating pathway - multiple species
    110202713 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110202713 (AKT2)
   05205 Proteoglycans in cancer
    110202713 (AKT2)
   05230 Central carbon metabolism in cancer
    110202713 (AKT2)
   05231 Choline metabolism in cancer
    110202713 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110202713 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110202713 (AKT2)
   05212 Pancreatic cancer
    110202713 (AKT2)
   05225 Hepatocellular carcinoma
    110202713 (AKT2)
   05226 Gastric cancer
    110202713 (AKT2)
   05214 Glioma
    110202713 (AKT2)
   05221 Acute myeloid leukemia
    110202713 (AKT2)
   05220 Chronic myeloid leukemia
    110202713 (AKT2)
   05218 Melanoma
    110202713 (AKT2)
   05211 Renal cell carcinoma
    110202713 (AKT2)
   05215 Prostate cancer
    110202713 (AKT2)
   05213 Endometrial cancer
    110202713 (AKT2)
   05224 Breast cancer
    110202713 (AKT2)
   05222 Small cell lung cancer
    110202713 (AKT2)
   05223 Non-small cell lung cancer
    110202713 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110202713 (AKT2)
   05017 Spinocerebellar ataxia
    110202713 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110202713 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110202713 (AKT2)
   04931 Insulin resistance
    110202713 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110202713 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110202713 (AKT2)
   05135 Yersinia infection
    110202713 (AKT2)
   05152 Tuberculosis
    110202713 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110202713 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    110202713 (AKT2)
   05161 Hepatitis B
    110202713 (AKT2)
   05160 Hepatitis C
    110202713 (AKT2)
   05164 Influenza A
    110202713 (AKT2)
   05162 Measles
    110202713 (AKT2)
   05168 Herpes simplex virus 1 infection
    110202713 (AKT2)
   05163 Human cytomegalovirus infection
    110202713 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110202713 (AKT2)
   05169 Epstein-Barr virus infection
    110202713 (AKT2)
   05165 Human papillomavirus infection
    110202713 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110202713 (AKT2)
   05142 Chagas disease
    110202713 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110202713 (AKT2)
   01524 Platinum drug resistance
    110202713 (AKT2)
   01522 Endocrine resistance
    110202713 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110202713 (AKT2)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110202713 (AKT2)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110202713 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 110202713
NCBI-ProteinID: XP_020834643
UniProt: A0A6P5JMP9
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVVKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEVPDQSLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKNQEPVEDAM
DYKCGSPSDSSVAEEMEVAVSKTRTKATMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTNDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMTCGRLPFYNQDHERLFE
LILLEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPRDAKEVMEHRFFSAINWQDVLQK
KLPPPFKPQVTSEIDTRYFDDEFTAQSITITPPDRYDSMGSLEPDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtccgtcgtcaaagaaggctggctccacaagagaggtgaatacatcaag
acctggagacctcgttacttcctgttaaaaagcgatggttcattcatcggctacaaagag
aggccagaggtccctgaccagagtttgccccctttaaataacttttctgtagcagaatgc
cagctaatgaaaacagagcgacctcggcccaacacctttgtcatccgatgcttgcaatgg
acaacggttatcgaaaggacctttcacgtggattctccagatgagagggaggagtggatg
agggccatccagatggtggccaacagcctgaagaatcaggagcccgtggaagacgcgatg
gactacaaatgtggctcccccagtgactcctcagtggccgaggagatggaagtggctgtc
agcaaaacacggacgaaggcgaccatgaatgactttgactatctcaagcttctgggcaaa
ggcacctttggcaaagtcatcctggtgcgggagaaggccacagggcgctactacgccatg
aagatcctgaggaaggaggtcatcatcgccaaggatgaagttgcccacacagtcactgag
agtcgagtcctacagaataccaggcacccgtttctcacagcactgaagtatgcctttcag
acaaatgaccgcctctgttttgtgatggagtatgccaacggtggggagctgtttttccac
ctgtcgagagagcgcgtcttcacggaggacagggcgcggttctacggggccgagatcgtc
tctgccttggagtacctgcactcccgggatgtggtctacagggacatcaagctggagaac
ctcatgctggacaaagacggacacatcaagatcactgactttggcctctgcaaggagggc
atcagtgacggggccaccatgaagaccttctgcggcaccccggagtacctagccccagag
gtgctggaggacaacgactacgggcgggcggtggactggtgggggctgggcgtggtgatg
tacgagatgacatgtggccggctgcccttctacaaccaggaccacgagcgcctcttcgag
ctgattctcctggaggagatccgttttccgcgcacgctcagccccgaggccaagtctctg
ctggctgggctgctgaagaaggaccccaagcagaggctgggcgggggaccccgggatgcc
aaggaggtcatggagcaccgcttcttctcggccatcaattggcaggatgtcttgcagaag
aagctcccacctccatttaagccccaggtcacatcagagattgacacacggtacttcgat
gatgaattcacagcgcagtccatcaccatcacccccccagaccgatatgacagcatgggc
tcccttgaacctgaccagcgcacccacttcccacagttctcttactcagccagcatccgg
gagtga

KEGG   Phascolarctos cinereus (koala): 110203042
Entry
110203042         CDS       T05867                                 

Gene name
AKT1
Definition
(RefSeq) LOW QUALITY PROTEIN: RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04022  cGMP-PKG signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04152  AMPK signaling pathway
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04213  Longevity regulating pathway - multiple species
pcw04218  Cellular senescence
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04370  VEGF signaling pathway
pcw04371  Apelin signaling pathway
pcw04380  Osteoclast differentiation
pcw04510  Focal adhesion
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04611  Platelet activation
pcw04613  Neutrophil extracellular trap formation
pcw04620  Toll-like receptor signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04668  TNF signaling pathway
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04728  Dopaminergic synapse
pcw04910  Insulin signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04915  Estrogen signaling pathway
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04922  Glucagon signaling pathway
pcw04923  Regulation of lipolysis in adipocytes
pcw04926  Relaxin signaling pathway
pcw04929  GnRH secretion
pcw04931  Insulin resistance
pcw04932  Non-alcoholic fatty liver disease
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw04973  Carbohydrate digestion and absorption
pcw05010  Alzheimer disease
pcw05017  Spinocerebellar ataxia
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05142  Chagas disease
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110203042 (AKT1)
   04012 ErbB signaling pathway
    110203042 (AKT1)
   04014 Ras signaling pathway
    110203042 (AKT1)
   04015 Rap1 signaling pathway
    110203042 (AKT1)
   04370 VEGF signaling pathway
    110203042 (AKT1)
   04371 Apelin signaling pathway
    110203042 (AKT1)
   04630 JAK-STAT signaling pathway
    110203042 (AKT1)
   04668 TNF signaling pathway
    110203042 (AKT1)
   04066 HIF-1 signaling pathway
    110203042 (AKT1)
   04068 FoxO signaling pathway
    110203042 (AKT1)
   04072 Phospholipase D signaling pathway
    110203042 (AKT1)
   04071 Sphingolipid signaling pathway
    110203042 (AKT1)
   04024 cAMP signaling pathway
    110203042 (AKT1)
   04022 cGMP-PKG signaling pathway
    110203042 (AKT1)
   04151 PI3K-Akt signaling pathway
    110203042 (AKT1)
   04152 AMPK signaling pathway
    110203042 (AKT1)
   04150 mTOR signaling pathway
    110203042 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110203042 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    110203042 (AKT1)
   04218 Cellular senescence
    110203042 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110203042 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110203042 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110203042 (AKT1)
   04613 Neutrophil extracellular trap formation
    110203042 (AKT1)
   04620 Toll-like receptor signaling pathway
    110203042 (AKT1)
   04625 C-type lectin receptor signaling pathway
    110203042 (AKT1)
   04660 T cell receptor signaling pathway
    110203042 (AKT1)
   04662 B cell receptor signaling pathway
    110203042 (AKT1)
   04664 Fc epsilon RI signaling pathway
    110203042 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    110203042 (AKT1)
   04062 Chemokine signaling pathway
    110203042 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110203042 (AKT1)
   04922 Glucagon signaling pathway
    110203042 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    110203042 (AKT1)
   04920 Adipocytokine signaling pathway
    110203042 (AKT1)
   04929 GnRH secretion
    110203042 (AKT1)
   04915 Estrogen signaling pathway
    110203042 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    110203042 (AKT1)
   04917 Prolactin signaling pathway
    110203042 (AKT1)
   04926 Relaxin signaling pathway
    110203042 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    110203042 (AKT1)
   04919 Thyroid hormone signaling pathway
    110203042 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110203042 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110203042 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    110203042 (AKT1)
   04728 Dopaminergic synapse
    110203042 (AKT1)
   04722 Neurotrophin signaling pathway
    110203042 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110203042 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    110203042 (AKT1)
   04213 Longevity regulating pathway - multiple species
    110203042 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110203042 (AKT1)
   05205 Proteoglycans in cancer
    110203042 (AKT1)
   05230 Central carbon metabolism in cancer
    110203042 (AKT1)
   05231 Choline metabolism in cancer
    110203042 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110203042 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110203042 (AKT1)
   05212 Pancreatic cancer
    110203042 (AKT1)
   05225 Hepatocellular carcinoma
    110203042 (AKT1)
   05226 Gastric cancer
    110203042 (AKT1)
   05214 Glioma
    110203042 (AKT1)
   05221 Acute myeloid leukemia
    110203042 (AKT1)
   05220 Chronic myeloid leukemia
    110203042 (AKT1)
   05218 Melanoma
    110203042 (AKT1)
   05211 Renal cell carcinoma
    110203042 (AKT1)
   05215 Prostate cancer
    110203042 (AKT1)
   05213 Endometrial cancer
    110203042 (AKT1)
   05224 Breast cancer
    110203042 (AKT1)
   05222 Small cell lung cancer
    110203042 (AKT1)
   05223 Non-small cell lung cancer
    110203042 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110203042 (AKT1)
   05017 Spinocerebellar ataxia
    110203042 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110203042 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110203042 (AKT1)
   04931 Insulin resistance
    110203042 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110203042 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110203042 (AKT1)
   05135 Yersinia infection
    110203042 (AKT1)
   05152 Tuberculosis
    110203042 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110203042 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    110203042 (AKT1)
   05161 Hepatitis B
    110203042 (AKT1)
   05160 Hepatitis C
    110203042 (AKT1)
   05164 Influenza A
    110203042 (AKT1)
   05162 Measles
    110203042 (AKT1)
   05168 Herpes simplex virus 1 infection
    110203042 (AKT1)
   05163 Human cytomegalovirus infection
    110203042 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110203042 (AKT1)
   05169 Epstein-Barr virus infection
    110203042 (AKT1)
   05165 Human papillomavirus infection
    110203042 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110203042 (AKT1)
   05142 Chagas disease
    110203042 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110203042 (AKT1)
   01524 Platinum drug resistance
    110203042 (AKT1)
   01522 Endocrine resistance
    110203042 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110203042 (AKT1)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110203042 (AKT1)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110203042 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 110203042
NCBI-ProteinID: XP_020835126
UniProt: A0A6P5JUQ5
LinkDB
Position
Unknown
AA seq 480 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQMVADSLKKQEEEMMDF
RSGSPSDNSGAEEMEVSTTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPDAKSLLSGLLKKDPKQRLGGGSDDAKEIMQHKFFAGIVWQDVYEKK
LVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDNERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgttgcgattgttaaggagggctggctgcataagcgaggagaatacatcaaa
acatggcggccacgctacttcttgctgaagagtgatgggagcttcattggctacaaggag
cggccacaggacgtggaccagcgggagtcacccctcaacaacttctcagttgcacaatgc
cagctgatgaagacagagcgacccaaacccaatacattcatcatccgctgcctgcagtgg
accacggtaattgagagaacgtttcacgtggagacccccgaggagcgggaagaatggacc
aaagccatacagatggtggctgacagcctgaaaaagcaagaggaagaaatgatggacttc
cggtcaggttcaccgagtgacaattccggggccgaggagatggaggtgtctacgacaaag
cccaaacacaaagtgacaatgaatgaattcgaatacctgaagctgctgggcaaaggcaca
tttgggaaggtgatcctggtgaaggagaaggcgaccgggagatactatgccatgaagatc
ctcaagaaggaagtgattgtggccaaggatgaggtggcacatacgcttacagagaaccga
gtcttgcagaactcaaggcacccgttcctgacagcactgaagtactcattccagacgcat
gaccgcctatgctttgtgatggagtatgccaatggaggagagctgtttttccatctctcc
cgagagcgggtattctccgaagaccgagccagattctacggggcagagattgtgtctgcg
ctggactacttgcattctgagaagaatgtagtgtacagggacctcaagttggaaaaccta
atgctggacaaagatggtcacatcaaaatcaccgacttcggtctgtgcaaggaggggatc
aaagatggtgctacaatgaagaccttctgtgggactccagaatatctggcccctgaggtg
ctagaagacaatgactatggccgggcagtggactggtggggcctaggagtggtgatgtat
gagatgatgtgtggccggctgcccttctacaaccaggaccatgagaagctgtttgagctg
atccttatggaggagattcgattcccccgaacgctctccccggatgccaagtctcttctg
tcggggttgctaaaaaaggaccccaagcagaggttaggtgggggatcagacgatgcaaaa
gagattatgcagcacaagttttttgctggcattgtatggcaagatgtctatgaaaaaaag
ctggtgcctccttttaagccgcaagtgacatctgagacagacaccaggtattttgatgag
gagtttacagcccagatgatcacaatcacccctcctgaccaagatgacaacatggagtgt
gtggacaatgagagacggccccactttcctcagttctcatactctgctagtgggacagcg
tga

KEGG   Phascolarctos cinereus (koala): 110205475
Entry
110205475         CDS       T05867                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04022  cGMP-PKG signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04152  AMPK signaling pathway
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04213  Longevity regulating pathway - multiple species
pcw04218  Cellular senescence
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04370  VEGF signaling pathway
pcw04371  Apelin signaling pathway
pcw04380  Osteoclast differentiation
pcw04510  Focal adhesion
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04611  Platelet activation
pcw04613  Neutrophil extracellular trap formation
pcw04620  Toll-like receptor signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04668  TNF signaling pathway
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04728  Dopaminergic synapse
pcw04910  Insulin signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04915  Estrogen signaling pathway
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04922  Glucagon signaling pathway
pcw04923  Regulation of lipolysis in adipocytes
pcw04926  Relaxin signaling pathway
pcw04929  GnRH secretion
pcw04931  Insulin resistance
pcw04932  Non-alcoholic fatty liver disease
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw04973  Carbohydrate digestion and absorption
pcw05010  Alzheimer disease
pcw05017  Spinocerebellar ataxia
pcw05132  Salmonella infection
pcw05135  Yersinia infection
pcw05142  Chagas disease
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110205475 (AKT3)
   04012 ErbB signaling pathway
    110205475 (AKT3)
   04014 Ras signaling pathway
    110205475 (AKT3)
   04015 Rap1 signaling pathway
    110205475 (AKT3)
   04370 VEGF signaling pathway
    110205475 (AKT3)
   04371 Apelin signaling pathway
    110205475 (AKT3)
   04630 JAK-STAT signaling pathway
    110205475 (AKT3)
   04668 TNF signaling pathway
    110205475 (AKT3)
   04066 HIF-1 signaling pathway
    110205475 (AKT3)
   04068 FoxO signaling pathway
    110205475 (AKT3)
   04072 Phospholipase D signaling pathway
    110205475 (AKT3)
   04071 Sphingolipid signaling pathway
    110205475 (AKT3)
   04024 cAMP signaling pathway
    110205475 (AKT3)
   04022 cGMP-PKG signaling pathway
    110205475 (AKT3)
   04151 PI3K-Akt signaling pathway
    110205475 (AKT3)
   04152 AMPK signaling pathway
    110205475 (AKT3)
   04150 mTOR signaling pathway
    110205475 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110205475 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    110205475 (AKT3)
   04218 Cellular senescence
    110205475 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110205475 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    110205475 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110205475 (AKT3)
   04613 Neutrophil extracellular trap formation
    110205475 (AKT3)
   04620 Toll-like receptor signaling pathway
    110205475 (AKT3)
   04625 C-type lectin receptor signaling pathway
    110205475 (AKT3)
   04660 T cell receptor signaling pathway
    110205475 (AKT3)
   04662 B cell receptor signaling pathway
    110205475 (AKT3)
   04664 Fc epsilon RI signaling pathway
    110205475 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    110205475 (AKT3)
   04062 Chemokine signaling pathway
    110205475 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110205475 (AKT3)
   04922 Glucagon signaling pathway
    110205475 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    110205475 (AKT3)
   04920 Adipocytokine signaling pathway
    110205475 (AKT3)
   04929 GnRH secretion
    110205475 (AKT3)
   04915 Estrogen signaling pathway
    110205475 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    110205475 (AKT3)
   04917 Prolactin signaling pathway
    110205475 (AKT3)
   04926 Relaxin signaling pathway
    110205475 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    110205475 (AKT3)
   04919 Thyroid hormone signaling pathway
    110205475 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110205475 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110205475 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    110205475 (AKT3)
   04728 Dopaminergic synapse
    110205475 (AKT3)
   04722 Neurotrophin signaling pathway
    110205475 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110205475 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    110205475 (AKT3)
   04213 Longevity regulating pathway - multiple species
    110205475 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110205475 (AKT3)
   05205 Proteoglycans in cancer
    110205475 (AKT3)
   05230 Central carbon metabolism in cancer
    110205475 (AKT3)
   05231 Choline metabolism in cancer
    110205475 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110205475 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110205475 (AKT3)
   05212 Pancreatic cancer
    110205475 (AKT3)
   05225 Hepatocellular carcinoma
    110205475 (AKT3)
   05226 Gastric cancer
    110205475 (AKT3)
   05214 Glioma
    110205475 (AKT3)
   05221 Acute myeloid leukemia
    110205475 (AKT3)
   05220 Chronic myeloid leukemia
    110205475 (AKT3)
   05218 Melanoma
    110205475 (AKT3)
   05211 Renal cell carcinoma
    110205475 (AKT3)
   05215 Prostate cancer
    110205475 (AKT3)
   05213 Endometrial cancer
    110205475 (AKT3)
   05224 Breast cancer
    110205475 (AKT3)
   05222 Small cell lung cancer
    110205475 (AKT3)
   05223 Non-small cell lung cancer
    110205475 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110205475 (AKT3)
   05017 Spinocerebellar ataxia
    110205475 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110205475 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110205475 (AKT3)
   04931 Insulin resistance
    110205475 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110205475 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110205475 (AKT3)
   05135 Yersinia infection
    110205475 (AKT3)
   05152 Tuberculosis
    110205475 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110205475 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    110205475 (AKT3)
   05161 Hepatitis B
    110205475 (AKT3)
   05160 Hepatitis C
    110205475 (AKT3)
   05164 Influenza A
    110205475 (AKT3)
   05162 Measles
    110205475 (AKT3)
   05168 Herpes simplex virus 1 infection
    110205475 (AKT3)
   05163 Human cytomegalovirus infection
    110205475 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110205475 (AKT3)
   05169 Epstein-Barr virus infection
    110205475 (AKT3)
   05165 Human papillomavirus infection
    110205475 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110205475 (AKT3)
   05142 Chagas disease
    110205475 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110205475 (AKT3)
   01524 Platinum drug resistance
    110205475 (AKT3)
   01522 Endocrine resistance
    110205475 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110205475 (AKT3)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110205475 (AKT3)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   110205475 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like PH FTA2
Other DBs
NCBI-GeneID: 110205475
NCBI-ProteinID: XP_020837737
UniProt: A0A6P5JU20
LinkDB
Position
Unknown
AA seq 536 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKSE
TSPNNTTFWSLKSFLGMHCLNHSRGKEAYQLRRKPSYFSIVYRTLGGECQLMKTERPKPN
TFIIRCLQWTTVIERTFHVDTPEERSLAFFFLEEWTEAIQAVADRLQRQEEERMNCSPTS
QIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEV
IIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVF
SEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDI
KFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFVGVNWQDVYDKKLVPPFK
PQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaggag
aaacctcaagatgtggatttaccttatccccttaacaacttttcagtggcaaaaagtgaa
acatctcccaacaatactaccttttggtcactgaagtcttttctggggatgcattgtctg
aaccattccagaggcaaagaagcctaccagttgaggaggaaaccaagctatttctccatt
gtatacagaactcttggaggggaatgccaactcatgaaaacagaacgaccaaagccaaat
acatttattatcagatgcctccagtggaccactgttatagaacgaacatttcatgtggat
actccagaggaaaggtcacttgcttttttttttttggaagaatggacagaagctatccag
gctgtagcagacagacttcagaggcaagaagaagagagaatgaactgtagtccgacttca
caaattgataatataggagaggaggaaatggatgcttctacaactcatcataaaagaaag
acaatgaatgactttgactatttgaaactgttgggtaaaggcacttttggaaaagtgatt
ttggttcgagagaaggcaagtggaaaatattatgctatgaagattttgaagaaagaagta
attattgcaaaggatgaagtggcacatactctaacagaaagcagagtattaaaaaacact
aggcacccctttttaacttctttgaaatattccttccagacaaaagatcgtttgtgtttt
gtgatggagtatgttaatggaggagagctgtttttccatttgtcgagagagcgggtgttc
tctgaggaccgcacacgcttctatggtgcagaaattgtctcagctttggactatctacat
tctggaaagattgtgtaccgtgatctcaagttggaaaatttgatgttggataaagatggc
cacataaaaattacagattttggactttgcaaagaagggattacagatgcagctacgatg
aagacattttgtggtacacctgagtaccttgcacctgaggtattagaagataatgactat
ggccgtgcagtagactggtggggcctgggggttgtcatgtatgaaatgatgtgtgggaga
ttaccattctacaaccaggatcatgagaaactttttgagctaatattaatggaggacatt
aaatttcctcgaactctttcttctgatgcaaaatccttactttcaggactcttaataaaa
gatccaaataaacgccttggcggaggtccagatgatgcaaaagaaattatgaggcatagt
ttctttgttggagtaaactggcaagatgtatatgataaaaagctggtacctccttttaaa
cctcaagtaacgtctgagacagacaccagatattttgatgaagaatttacagctcagaca
attacaataacaccgcctgaaaaatatgatgaggatggtatggactgcatggacaatgag
agacggccacatttcccacagttttcctactctgcaagtggacgagaataa

DBGET integrated database retrieval system