KEGG   Phascolarctos cinereus (koala): 110202831
Entry
110202831         CDS       T05867                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04060  Cytokine-cytokine receptor interaction
pcw04066  HIF-1 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04640  Hematopoietic cell lineage
pcw05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110202831 (EPO)
   04066 HIF-1 signaling pathway
    110202831 (EPO)
   04151 PI3K-Akt signaling pathway
    110202831 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110202831 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110202831 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110202831 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcw04052]
    110202831 (EPO)
Cytokines and growth factors [BR:pcw04052]
 Cytokines
  CSF and other factors
   110202831 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 110202831
NCBI-ProteinID: XP_020834841
LinkDB
Position
Unknown
AA seq 190 aa
MGVHEFLVLLQLLLLHLGVPVWGSPQSPFCDSHILERYILEAKEAQNATTVACMEDCSLG
ENITVPDTRVNFHTWKKMEVGQKAGEVWQGLTLLSEAVLKGQALLANSSQTPVALKLFVD
KAVSSLRSLRFLLRGLGAQEEAIYVPDAPTAAPFRTFTVGTMDKLFRIYSNFLRGKLKLF
LREACQKEER
NT seq 573 nt   +upstreamnt  +downstreamnt
atgggggttcatgaatttcttgttctgctgcagctgctgctacttcaccttggagttccg
gtgtggggctctccacagtcccccttctgtgatagccacatcctggagaggtacatcctt
gaggccaaagaagcacagaatgctacaacggtagcctgcatggaagattgcagcctgggt
gagaacatcacagtccctgataccagggtgaacttccatacctggaagaagatggaggtg
gggcagaaggcaggggaggtctggcaggggctgaccctgctctccgaagctgtcctaaaa
gggcaggccttgctggccaactcctctcagacaccagtagcgctaaagctctttgtggac
aaagctgtcagcagcttgagaagtctcagattcctgcttcgaggactgggagcacaggaa
gaagctatctatgttccagatgccccaacagcagctccatttcgtaccttcacggttggg
accatggacaaactttttcgaatctactccaatttcctacggggaaagctcaagttgttt
ttgagggaagcctgccaaaaagaggagaggtga

DBGET integrated database retrieval system