KEGG   Phascolarctos cinereus (koala): 110202946
Entry
110202946         CDS       T05867                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04010  MAPK signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04020  Calcium signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04360  Axon guidance
pcw04510  Focal adhesion
pcw04520  Adherens junction
pcw05100  Bacterial invasion of epithelial cells
pcw05144  Malaria
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05211  Renal cell carcinoma
pcw05218  Melanoma
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110202946 (MET)
   04014 Ras signaling pathway
    110202946 (MET)
   04015 Rap1 signaling pathway
    110202946 (MET)
   04020 Calcium signaling pathway
    110202946 (MET)
   04151 PI3K-Akt signaling pathway
    110202946 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110202946 (MET)
   04520 Adherens junction
    110202946 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110202946 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110202946 (MET)
   05202 Transcriptional misregulation in cancer
    110202946 (MET)
   05206 MicroRNAs in cancer
    110202946 (MET)
   05205 Proteoglycans in cancer
    110202946 (MET)
   05230 Central carbon metabolism in cancer
    110202946 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110202946 (MET)
   05226 Gastric cancer
    110202946 (MET)
   05218 Melanoma
    110202946 (MET)
   05211 Renal cell carcinoma
    110202946 (MET)
   05223 Non-small cell lung cancer
    110202946 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110202946 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    110202946 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110202946 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110202946 (MET)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110202946 (MET)
Protein kinases [BR:pcw01001]
 Receptor tyrosine kinases (RTK)
  MET family
   110202946 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal LapA_dom
Other DBs
NCBI-GeneID: 110202946
NCBI-ProteinID: XP_020834976
UniProt: A0A6P5JUC3
LinkDB
Position
Unknown
AA seq 1379 aa
MKPTAVLMPRIIIFLLAWVPNCKGECKEALVKSEMDINRKYPLPNFIAETPIQNVVFHNH
HIFLGAVNKIYVLNEDLHNVSEYKTGPVLEHPDCSPCQDCSPKANLSGSVWKDNVNKALL
IDTYYDDQLISCGSVNRGTCQRHVFQPNNAADIQSKVYCIYSPQIDEESLQCPDCVVSTL
GTKVLLTEKDRFINFFVGNTINSSYPDHFLHSISVRRLKETQDGFKFLTDQSYFDVLPEF
QDSYPIKYIHAFESSDFIYFLTVQRETLESQTFHTRIIRFCSVDSGLHSYTEMPLECILT
EKRRKRSTREEVFNVLQAAYVSKPGAHLARQIGVGPNDDIIFGVFAQSKPDSSEPIKRSA
VCAFPIKFVNDFFNRIVNKNNVRCLQHFYGNNHKNCFNRTFLRNSSGCEARDDEYRTEFT
TGLQRIDLFTGQFKQVLLTSISTFIKGDLTIANLGTSDGRFMQVVVSRGQSTPHVNFQLD
SHPVSPEVIVEQPLNTDGFTLVITGKKITKIPLNGLGCDHFKSCSQCLSAPPFVQCTWCH
NQCVKSEECVTELGNQDICLPTIYEILPTSAPLEGGTTLTVCGWDFGLRKNNKFDFRKTK
ILIGNESCILNTSESTTNKLKCTVGPAMNLHFNVSIIISNGRETTQFNSFSYVDPVITNI
SPSYGPKAGGTLLTLTGKYLNSGNSRRISIGGKPCILKSVSHSVLECYTPAQTMPTAYPI
KMKIDLANREAYSFTYKEDPIVHEIHPTKSFLSGGSTITGLGKNLNSASVPKMVINVPEV
GRNFTVACKHRSNSEIICCSTPSLQQLNLQPPLETKALFIFDGIHSTYFDLIYVHNPVFK
PFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIRLHSEAVLCTVPNDLLK
LNSELNIEWKQAVSSTVLGKVIVQPDQNFTGLIVGVVLISLVLFLLLGLFLWLKKRKQIK
DLGSDLVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCR
QAHYPLTDLSPILNSGDSDISSPLLQNHVHIDISALNPDLVQAVQHVVIGPNSLIVHFNE
IIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDLGEVSQFLTEGIIMKDFSHPNVLSL
LGICLRNEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVH
RDLAARNCMLDEKFTVKVADFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHP
KAEMRPSFSELVSKISVIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDREVDT
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgaagcccactgctgtgcttatgcccaggattataatcttcctgcttgcctgggtgcca
aattgcaaaggagagtgtaaggaagcactagtcaagtctgagatggacattaataggaag
tatccacttcccaactttattgcagaaaccccaatccagaatgttgtttttcacaatcac
cacatcttcctgggtgcagtcaacaagatttatgtcttaaatgaagatcttcataatgtt
tctgagtacaagacaggacctgtgctggaacaccctgattgttctccatgtcaagactgt
agtcccaaagctaacttatcaggtagtgtttggaaggataatgtcaacaaggctttactt
attgatacctactatgatgaccagctgattagttgtggcagtgtcaatcgagggacctgc
cagcgccacgtgtttcagcccaataatgctgctgatatacagtcaaaagtttattgtata
tattccccacagatagatgaggaatccctccaatgtcctgactgtgtggtaagcacttta
gggaccaaagttctgctgacggaaaaagaccggtttattaacttctttgtgggcaatacc
ataaattcttcttatcctgatcatttcttacattcaatatctgttaggaggctaaaggaa
acacaagatggttttaagtttttgacagaccaatcctattttgatgtcctacctgaattc
caagattcttaccccattaaatatatacatgcctttgaaagcagtgacttcatttatttt
ctgacagtccaaagagaaactctcgagtctcagacttttcacacaagaataatcaggttc
tgttcagttgactctggattgcattcatacacggaaatgcctcttgaatgtatccttact
gaaaagagaaggaagaggtcaacaagagaagaagtatttaatgttctacaagctgcatac
gtgagtaagcctggtgcacatctggcgaggcaaataggagttggacccaacgatgacatt
atctttggggtatttgcacaaagtaaaccggactcctcagaaccaatcaagagatcagca
gtctgtgcattcccaatcaaatttgtcaatgatttcttcaacagaattgtgaacaaaaat
aatgtgagatgtcttcagcatttttatgggaacaatcacaagaactgttttaataggaca
tttttaagaaactcatcaggctgtgaagcaagagatgatgaatataggacagaatttacc
acaggattgcaacgtatcgatttattcacaggacaattcaagcaagttcttttaacatca
atatctacctttatcaaaggagacctgactattgcaaaccttggaacatcagatggtcga
tttatgcaggttgtggtttctcgaggacaatcaacccctcatgtgaattttcaactggat
tcccatcccgtttctccggaagtgattgttgagcagccattaaatacagatggcttcaca
ctagttatcactgggaagaagataaccaagatcccattgaatggccttggttgtgaccat
tttaagtcctgcagtcagtgtctctcagcccctccttttgtgcagtgtacctggtgccat
aatcaatgtgtgaaatctgaggaatgtgtcactgagctaggcaaccaagatatttgtctg
cctactatttatgagattctcccgaccagcgcacccctggagggaggcacaacgttgaca
gtgtgtggctgggattttggattaagaaaaaataataaatttgattttagaaaaaccaaa
attctcattggaaatgagagctgcatactgaatacaagtgagagcaccacaaataagttg
aaatgtactgttggtcctgctatgaatctgcatttcaatgtatccatcattatttcaaat
ggtcgagaaacaacacaatttaattcattctcttatgtggatcctgtaataacaaatatt
tctccaagctatggtcccaaggctggtggtacattacttaccttaactgggaaatatcta
aacagtggaaattctagacgtatttcaattggtgggaaaccatgtattttaaaaagtgtg
tctcatagtgttctagaatgttatactcctgcacaaaccatgccaactgcataccccatt
aaaatgaaaattgacttagccaatcgagaagcctacagttttacatacaaagaggacccc
attgtccatgaaattcatccaaccaaatcctttcttagtggaggaagcacaataacaggt
cttgggaaaaatctaaattctgctagtgttcccaagatggtaataaatgtccctgaagta
ggaaggaacttcacagtggcatgcaagcaccgctctaattcagagataatctgttgttcg
actccttccttacaacagctaaatctgcaacctcccctggaaacaaaagctcttttcata
tttgatggtatccattccacttactttgatctcatttatgtccataatcctgtatttaag
ccttttgaaaagccagtgatgatctcaatgggcaacgaaaatgtactggaaattaaggga
aatgatattgaccctgaggcagtaaaaggtgaagtgttaaaagtgggaaataagagctgt
gagaatatccgcttgcactctgaagcagtcttatgtacggtccccaacgacctgctgaaa
ctgaatagcgagctaaatatagagtggaagcaagcagtttcttcaactgtccttggaaaa
gtgatagtacaaccagaccaaaatttcacaggactcattgttggagttgtcttgatatca
ttggtgctctttttattactggggctttttctgtggctgaaaaagaggaagcagattaaa
gatctgggcagtgacttagttcgctatgatgcaagagtacacactcctcacttggatagg
cttgtaagtgcccggagtgtaagccctaccacggaaatggtttcaaatgaatctgtagac
tacagagcaacttttccagaagatcagtttccaaattcttcccaaaatggatcctgcaga
caagctcattatcctctgacagatttgtcccccatcctaaacagtggagattcagatata
tccagtccgctgcttcaaaatcatgtccacattgatatcagcgccttaaatccagacctg
gtccaagcagtccaacatgtggttattgggccaaacagcctgattgtgcatttcaatgaa
atcataggaagagggcattttgggtgtgtgtatcatgggactttattggataacgatgat
aagaagattcattgtgctgtgaagtccttgaatagaattactgacctaggagaggtttca
caatttctgactgaagggatcatcatgaaagattttagtcaccccaatgtcctctcactt
ttgggaatctgccttcgtaatgaagggtctccattggtggtcctgccatacatgaaacat
ggagatcttcgaaacttcataagaaatgagactcataacccaacagtgaaagatcttatt
ggttttggtcttcaagtagccaaaggtatgaaataccttgcaagcaaaaagtttgtccac
agagacttggcagcaagaaattgtatgctggatgaaaaattcactgtcaaggttgctgat
tttgggcttgccagagatgtgtatgataaagaatattacagtgtgcacaataaaacagga
gcaaaactgccagtgaaatggatggctttagaaagtttgcaaactcagaagtttactaca
aagtcagatgtgtggtcttttggagtgcttctctgggaactaatgactagaggagcacct
ccttatcctgatgttaatacctttgatataacagtttacttattgcaaggtcgaaggctc
ttgcagcctgaatactgcccagatccactgtatgaagtcatgctaaaatgctggcaccca
aaagctgaaatgcgtccctccttctctgaactggtctcaaagatatcagtcatattctcc
acattcattggagagcattatgttcacgtgaatgcaacctatgtcaatgtaaaatgtgtt
gccccttacccttcccttttgtcatcccaagacaacgtagacagggaagtggacacctga

DBGET integrated database retrieval system