KEGG   Phascolarctos cinereus (koala): 110203137
Entry
110203137         CDS       T05867                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04115  p53 signaling pathway
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04932  Non-alcoholic fatty liver disease
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05017  Spinocerebellar ataxia
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05134  Legionellosis
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05210  Colorectal cancer
pcw05222  Small cell lung cancer
pcw05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110203137
   04215 Apoptosis - multiple species
    110203137
   04115 p53 signaling pathway
    110203137
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110203137
  09162 Cancer: specific types
   05210 Colorectal cancer
    110203137
   05222 Small cell lung cancer
    110203137
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110203137
   05012 Parkinson disease
    110203137
   05014 Amyotrophic lateral sclerosis
    110203137
   05016 Huntington disease
    110203137
   05017 Spinocerebellar ataxia
    110203137
   05020 Prion disease
    110203137
   05022 Pathways of neurodegeneration - multiple diseases
    110203137
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110203137
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110203137
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110203137
   05134 Legionellosis
    110203137
   05152 Tuberculosis
    110203137
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110203137
   05161 Hepatitis B
    110203137
   05160 Hepatitis C
    110203137
   05164 Influenza A
    110203137
   05162 Measles
    110203137
   05168 Herpes simplex virus 1 infection
    110203137
   05163 Human cytomegalovirus infection
    110203137
   05167 Kaposi sarcoma-associated herpesvirus infection
    110203137
   05169 Epstein-Barr virus infection
    110203137
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110203137
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110203137
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Dehyd-heme_bind
Other DBs
NCBI-GeneID: 110203137
NCBI-ProteinID: XP_020835276
UniProt: A0A6P5JV38
LinkDB
Position
Unknown
AA seq 105 aa
MGDLEKGKKIFVQKCAQCHTVEKWGKHKTGPNLNGLFGQKIVQFPGFSYTDANKSKGIIW
GEDMLMEYLENPKKYIPGTKMIFTGIKKKGERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgacttggagaagggcaagaagatctttgttcagaagtgtgctcagtgccacacc
gtcgagaagtggggcaagcacaagacggggcccaatctgaacggcctctttggccaaaag
atcgtccagtttcccggcttctcctacacagatgccaacaagagcaaaggtatcatctgg
ggagaggatatgctgatggaatacctggaaaaccccaagaagtatatccctggaaccaaa
atgatcttcacaggcattaagaagaagggagaaagggcagacttgatagcataccttaag
aaggccaccaatgagtaa

KEGG   Phascolarctos cinereus (koala): 110213139
Entry
110213139         CDS       T05867                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04115  p53 signaling pathway
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04932  Non-alcoholic fatty liver disease
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05017  Spinocerebellar ataxia
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05134  Legionellosis
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05210  Colorectal cancer
pcw05222  Small cell lung cancer
pcw05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110213139
   04215 Apoptosis - multiple species
    110213139
   04115 p53 signaling pathway
    110213139
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110213139
  09162 Cancer: specific types
   05210 Colorectal cancer
    110213139
   05222 Small cell lung cancer
    110213139
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110213139
   05012 Parkinson disease
    110213139
   05014 Amyotrophic lateral sclerosis
    110213139
   05016 Huntington disease
    110213139
   05017 Spinocerebellar ataxia
    110213139
   05020 Prion disease
    110213139
   05022 Pathways of neurodegeneration - multiple diseases
    110213139
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110213139
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110213139
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110213139
   05134 Legionellosis
    110213139
   05152 Tuberculosis
    110213139
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110213139
   05161 Hepatitis B
    110213139
   05160 Hepatitis C
    110213139
   05164 Influenza A
    110213139
   05162 Measles
    110213139
   05168 Herpes simplex virus 1 infection
    110213139
   05163 Human cytomegalovirus infection
    110213139
   05167 Kaposi sarcoma-associated herpesvirus infection
    110213139
   05169 Epstein-Barr virus infection
    110213139
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110213139
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110213139
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 110213139
NCBI-ProteinID: XP_020849044
UniProt: A0A6P5KWN9
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLNGLFGRKTGQSPGFTYTDANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgacgtggagaagggcaagaagatctttgttcagaagtgtgctcagtgccacact
gtcgagaaggggggcaagcacaagacggggcccaatctgaacggcctttttggccgaaag
accggccagtctccgggcttcacctatacagatgccaacaagaacaaaggtatcatctgg
ggagaggatacgctgatggagtacctggaaaaccccaagaagtatatccctggaaccaaa
atgatcttcgcaggcattaagaagaagggagaaagggcagacttgatagcataccttaag
aaggccaccaatgagtaa

KEGG   Phascolarctos cinereus (koala): 110218003
Entry
110218003         CDS       T05867                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04115  p53 signaling pathway
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04932  Non-alcoholic fatty liver disease
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05017  Spinocerebellar ataxia
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05134  Legionellosis
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05210  Colorectal cancer
pcw05222  Small cell lung cancer
pcw05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110218003
   04215 Apoptosis - multiple species
    110218003
   04115 p53 signaling pathway
    110218003
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110218003
  09162 Cancer: specific types
   05210 Colorectal cancer
    110218003
   05222 Small cell lung cancer
    110218003
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110218003
   05012 Parkinson disease
    110218003
   05014 Amyotrophic lateral sclerosis
    110218003
   05016 Huntington disease
    110218003
   05017 Spinocerebellar ataxia
    110218003
   05020 Prion disease
    110218003
   05022 Pathways of neurodegeneration - multiple diseases
    110218003
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110218003
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110218003
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110218003
   05134 Legionellosis
    110218003
   05152 Tuberculosis
    110218003
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110218003
   05161 Hepatitis B
    110218003
   05160 Hepatitis C
    110218003
   05164 Influenza A
    110218003
   05162 Measles
    110218003
   05168 Herpes simplex virus 1 infection
    110218003
   05163 Human cytomegalovirus infection
    110218003
   05167 Kaposi sarcoma-associated herpesvirus infection
    110218003
   05169 Epstein-Barr virus infection
    110218003
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110218003
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110218003
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 NCKAP5
Other DBs
NCBI-GeneID: 110218003
NCBI-ProteinID: XP_020856200
UniProt: A0A6P5LCZ1
LinkDB
Position
Unknown
AA seq 105 aa
MGDMEKGKKIFVQKCAQCHTIEKGSKHKTGSNLNGLFGRKNSQSPSFSYTDANKNKGTIL
GGDTLMEYLENSKKYIPGTKLIFAGIKKKGERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgacatggagaagggcaagaagatctttgttcagaagtgtgctcagtgccacacc
atcgagaaggggagtaagcacaagacagggtccaatctgaatggcctctttggccgaaag
aacagccagtctcccagcttctcctacacagatgccaacaagaacaaaggtaccatcttg
ggaggagatacgctgatggaatacctggaaaactccaagaagtatatccctggaaccaaa
ctgatcttcgcaggcattaagaagaagggagaaagggcagacttgatagcataccttaag
aaggccaccaatgagtaa

KEGG   Phascolarctos cinereus (koala): 110218411
Entry
110218411         CDS       T05867                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04115  p53 signaling pathway
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04932  Non-alcoholic fatty liver disease
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05017  Spinocerebellar ataxia
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05134  Legionellosis
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05210  Colorectal cancer
pcw05222  Small cell lung cancer
pcw05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110218411
   04215 Apoptosis - multiple species
    110218411
   04115 p53 signaling pathway
    110218411
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110218411
  09162 Cancer: specific types
   05210 Colorectal cancer
    110218411
   05222 Small cell lung cancer
    110218411
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110218411
   05012 Parkinson disease
    110218411
   05014 Amyotrophic lateral sclerosis
    110218411
   05016 Huntington disease
    110218411
   05017 Spinocerebellar ataxia
    110218411
   05020 Prion disease
    110218411
   05022 Pathways of neurodegeneration - multiple diseases
    110218411
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110218411
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110218411
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110218411
   05134 Legionellosis
    110218411
   05152 Tuberculosis
    110218411
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110218411
   05161 Hepatitis B
    110218411
   05160 Hepatitis C
    110218411
   05164 Influenza A
    110218411
   05162 Measles
    110218411
   05168 Herpes simplex virus 1 infection
    110218411
   05163 Human cytomegalovirus infection
    110218411
   05167 Kaposi sarcoma-associated herpesvirus infection
    110218411
   05169 Epstein-Barr virus infection
    110218411
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110218411
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110218411
SSDB
Motif
Pfam: Cytochrom_C NCKAP5 Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 110218411
NCBI-ProteinID: XP_020856778
UniProt: A0A6P5LFY2
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKSKKISVHNCAWCHTIEKEGKHKTGPNLSGLFGGKTSQSPGFSYTDANKNKDIIW
GEDMLMEYLENPKEYIPGTKMILAGIKKKGERTDLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgtggagaagagcaagaagatctctgttcacaactgtgcttggtgccacacc
atcgagaaggaaggcaagcacaagacggggcccaatttgagtggcctctttggtggaaaa
accagccagtctcccggcttctcctacacagatgccaataagaacaaagatatcatctgg
ggagaggatatgctgatggaatacttggaaaaccccaaggagtatatccctggaaccaaa
atgatcttggcaggcattaagaagaagggagaaaggacagacttgatagcataccttaaa
aaggctaccaatgagtaa

DBGET integrated database retrieval system