Phascolarctos cinereus (koala): 110203137 Help Entry 110203137         CDS       T05867                                  Definition (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01524   Platinum drug resistance pcw04115   p53 signaling pathway pcw04210   Apoptosis pcw04215   Apoptosis - multiple species pcw04932   Non-alcoholic fatty liver disease pcw05010   Alzheimer disease pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05016   Huntington disease pcw05017   Spinocerebellar ataxia pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05132   Salmonella infection pcw05134   Legionellosis pcw05145   Toxoplasmosis pcw05152   Tuberculosis pcw05160   Hepatitis C pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05210   Colorectal cancer pcw05222   Small cell lung cancer pcw05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:pcw00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110203137    04215 Apoptosis - multiple species     110203137    04115 p53 signaling pathway     110203137  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110203137   09162 Cancer: specific types    05210 Colorectal cancer     110203137    05222 Small cell lung cancer     110203137   09164 Neurodegenerative disease    05010 Alzheimer disease     110203137    05012 Parkinson disease     110203137    05014 Amyotrophic lateral sclerosis     110203137    05016 Huntington disease     110203137    05017 Spinocerebellar ataxia     110203137    05020 Prion disease     110203137    05022 Pathways of neurodegeneration - multiple diseases     110203137   09166 Cardiovascular disease    05416 Viral myocarditis     110203137   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110203137   09171 Infectious disease: bacterial    05132 Salmonella infection     110203137    05134 Legionellosis     110203137    05152 Tuberculosis     110203137   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110203137    05161 Hepatitis B     110203137    05160 Hepatitis C     110203137    05164 Influenza A     110203137    05162 Measles     110203137    05168 Herpes simplex virus 1 infection     110203137    05163 Human cytomegalovirus infection     110203137    05167 Kaposi sarcoma-associated herpesvirus infection     110203137    05169 Epstein-Barr virus infection     110203137   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110203137   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110203137 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Dehyd-heme_bind Motif Other DBs NCBI-GeneID:  110203137 NCBI-ProteinID:  XP_020835276 UniProt:  A0A6P5JV38 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDLEKGKKIFVQKCAQCHTVEKWGKHKTGPNLNGLFGQKIVQFPGFSYTDANKSKGIIW GEDMLMEYLENPKKYIPGTKMIFTGIKKKGERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgacttggagaagggcaagaagatctttgttcagaagtgtgctcagtgccacacc gtcgagaagtggggcaagcacaagacggggcccaatctgaacggcctctttggccaaaag atcgtccagtttcccggcttctcctacacagatgccaacaagagcaaaggtatcatctgg ggagaggatatgctgatggaatacctggaaaaccccaagaagtatatccctggaaccaaa atgatcttcacaggcattaagaagaagggagaaagggcagacttgatagcataccttaag aaggccaccaatgagtaa

Phascolarctos cinereus (koala): 110213139 Help Entry 110213139         CDS       T05867                                  Definition (RefSeq) cytochrome c   KO K08738   cytochrome c Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01524   Platinum drug resistance pcw04115   p53 signaling pathway pcw04210   Apoptosis pcw04215   Apoptosis - multiple species pcw04932   Non-alcoholic fatty liver disease pcw05010   Alzheimer disease pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05016   Huntington disease pcw05017   Spinocerebellar ataxia pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05132   Salmonella infection pcw05134   Legionellosis pcw05145   Toxoplasmosis pcw05152   Tuberculosis pcw05160   Hepatitis C pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05210   Colorectal cancer pcw05222   Small cell lung cancer pcw05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:pcw00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110213139    04215 Apoptosis - multiple species     110213139    04115 p53 signaling pathway     110213139  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110213139   09162 Cancer: specific types    05210 Colorectal cancer     110213139    05222 Small cell lung cancer     110213139   09164 Neurodegenerative disease    05010 Alzheimer disease     110213139    05012 Parkinson disease     110213139    05014 Amyotrophic lateral sclerosis     110213139    05016 Huntington disease     110213139    05017 Spinocerebellar ataxia     110213139    05020 Prion disease     110213139    05022 Pathways of neurodegeneration - multiple diseases     110213139   09166 Cardiovascular disease    05416 Viral myocarditis     110213139   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110213139   09171 Infectious disease: bacterial    05132 Salmonella infection     110213139    05134 Legionellosis     110213139    05152 Tuberculosis     110213139   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110213139    05161 Hepatitis B     110213139    05160 Hepatitis C     110213139    05164 Influenza A     110213139    05162 Measles     110213139    05168 Herpes simplex virus 1 infection     110213139    05163 Human cytomegalovirus infection     110213139    05167 Kaposi sarcoma-associated herpesvirus infection     110213139    05169 Epstein-Barr virus infection     110213139   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110213139   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110213139 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  110213139 NCBI-ProteinID:  XP_020849044 UniProt:  A0A6P5KWN9 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLNGLFGRKTGQSPGFTYTDANKNKGIIW GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgacgtggagaagggcaagaagatctttgttcagaagtgtgctcagtgccacact gtcgagaaggggggcaagcacaagacggggcccaatctgaacggcctttttggccgaaag accggccagtctccgggcttcacctatacagatgccaacaagaacaaaggtatcatctgg ggagaggatacgctgatggagtacctggaaaaccccaagaagtatatccctggaaccaaa atgatcttcgcaggcattaagaagaagggagaaagggcagacttgatagcataccttaag aaggccaccaatgagtaa

Phascolarctos cinereus (koala): 110218003 Help Entry 110218003         CDS       T05867                                  Definition (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01524   Platinum drug resistance pcw04115   p53 signaling pathway pcw04210   Apoptosis pcw04215   Apoptosis - multiple species pcw04932   Non-alcoholic fatty liver disease pcw05010   Alzheimer disease pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05016   Huntington disease pcw05017   Spinocerebellar ataxia pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05132   Salmonella infection pcw05134   Legionellosis pcw05145   Toxoplasmosis pcw05152   Tuberculosis pcw05160   Hepatitis C pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05210   Colorectal cancer pcw05222   Small cell lung cancer pcw05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:pcw00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110218003    04215 Apoptosis - multiple species     110218003    04115 p53 signaling pathway     110218003  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110218003   09162 Cancer: specific types    05210 Colorectal cancer     110218003    05222 Small cell lung cancer     110218003   09164 Neurodegenerative disease    05010 Alzheimer disease     110218003    05012 Parkinson disease     110218003    05014 Amyotrophic lateral sclerosis     110218003    05016 Huntington disease     110218003    05017 Spinocerebellar ataxia     110218003    05020 Prion disease     110218003    05022 Pathways of neurodegeneration - multiple diseases     110218003   09166 Cardiovascular disease    05416 Viral myocarditis     110218003   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110218003   09171 Infectious disease: bacterial    05132 Salmonella infection     110218003    05134 Legionellosis     110218003    05152 Tuberculosis     110218003   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110218003    05161 Hepatitis B     110218003    05160 Hepatitis C     110218003    05164 Influenza A     110218003    05162 Measles     110218003    05168 Herpes simplex virus 1 infection     110218003    05163 Human cytomegalovirus infection     110218003    05167 Kaposi sarcoma-associated herpesvirus infection     110218003    05169 Epstein-Barr virus infection     110218003   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110218003   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110218003 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 NCKAP5 Motif Other DBs NCBI-GeneID:  110218003 NCBI-ProteinID:  XP_020856200 UniProt:  A0A6P5LCZ1 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDMEKGKKIFVQKCAQCHTIEKGSKHKTGSNLNGLFGRKNSQSPSFSYTDANKNKGTIL GGDTLMEYLENSKKYIPGTKLIFAGIKKKGERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgacatggagaagggcaagaagatctttgttcagaagtgtgctcagtgccacacc atcgagaaggggagtaagcacaagacagggtccaatctgaatggcctctttggccgaaag aacagccagtctcccagcttctcctacacagatgccaacaagaacaaaggtaccatcttg ggaggagatacgctgatggaatacctggaaaactccaagaagtatatccctggaaccaaa ctgatcttcgcaggcattaagaagaagggagaaagggcagacttgatagcataccttaag aaggccaccaatgagtaa

Phascolarctos cinereus (koala): 110218411 Help Entry 110218411         CDS       T05867                                  Definition (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01524   Platinum drug resistance pcw04115   p53 signaling pathway pcw04210   Apoptosis pcw04215   Apoptosis - multiple species pcw04932   Non-alcoholic fatty liver disease pcw05010   Alzheimer disease pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05016   Huntington disease pcw05017   Spinocerebellar ataxia pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05132   Salmonella infection pcw05134   Legionellosis pcw05145   Toxoplasmosis pcw05152   Tuberculosis pcw05160   Hepatitis C pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05210   Colorectal cancer pcw05222   Small cell lung cancer pcw05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:pcw00001]  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110218411    04215 Apoptosis - multiple species     110218411    04115 p53 signaling pathway     110218411  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110218411   09162 Cancer: specific types    05210 Colorectal cancer     110218411    05222 Small cell lung cancer     110218411   09164 Neurodegenerative disease    05010 Alzheimer disease     110218411    05012 Parkinson disease     110218411    05014 Amyotrophic lateral sclerosis     110218411    05016 Huntington disease     110218411    05017 Spinocerebellar ataxia     110218411    05020 Prion disease     110218411    05022 Pathways of neurodegeneration - multiple diseases     110218411   09166 Cardiovascular disease    05416 Viral myocarditis     110218411   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110218411   09171 Infectious disease: bacterial    05132 Salmonella infection     110218411    05134 Legionellosis     110218411    05152 Tuberculosis     110218411   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110218411    05161 Hepatitis B     110218411    05160 Hepatitis C     110218411    05164 Influenza A     110218411    05162 Measles     110218411    05168 Herpes simplex virus 1 infection     110218411    05163 Human cytomegalovirus infection     110218411    05167 Kaposi sarcoma-associated herpesvirus infection     110218411    05169 Epstein-Barr virus infection     110218411   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110218411   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110218411 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C NCKAP5 Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  110218411 NCBI-ProteinID:  XP_020856778 UniProt:  A0A6P5LFY2 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKSKKISVHNCAWCHTIEKEGKHKTGPNLSGLFGGKTSQSPGFSYTDANKNKDIIW GEDMLMEYLENPKEYIPGTKMILAGIKKKGERTDLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgtggagaagagcaagaagatctctgttcacaactgtgcttggtgccacacc atcgagaaggaaggcaagcacaagacggggcccaatttgagtggcctctttggtggaaaa accagccagtctcccggcttctcctacacagatgccaataagaacaaagatatcatctgg ggagaggatatgctgatggaatacttggaaaaccccaaggagtatatccctggaaccaaa atgatcttggcaggcattaagaagaagggagaaaggacagacttgatagcataccttaaa aaggctaccaatgagtaa

DBGET integrated database retrieval system