KEGG   Phascolarctos cinereus (koala): 110204990
Entry
110204990         CDS       T05867                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04020  Calcium signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04144  Endocytosis
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04520  Adherens junction
pcw04540  Gap junction
pcw04630  JAK-STAT signaling pathway
pcw04810  Regulation of actin cytoskeleton
pcw04912  GnRH signaling pathway
pcw04915  Estrogen signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04926  Relaxin signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110204990 (EGFR)
   04012 ErbB signaling pathway
    110204990 (EGFR)
   04014 Ras signaling pathway
    110204990 (EGFR)
   04015 Rap1 signaling pathway
    110204990 (EGFR)
   04630 JAK-STAT signaling pathway
    110204990 (EGFR)
   04066 HIF-1 signaling pathway
    110204990 (EGFR)
   04068 FoxO signaling pathway
    110204990 (EGFR)
   04020 Calcium signaling pathway
    110204990 (EGFR)
   04072 Phospholipase D signaling pathway
    110204990 (EGFR)
   04151 PI3K-Akt signaling pathway
    110204990 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110204990 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110204990 (EGFR)
   04520 Adherens junction
    110204990 (EGFR)
   04540 Gap junction
    110204990 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110204990 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    110204990 (EGFR)
   04915 Estrogen signaling pathway
    110204990 (EGFR)
   04921 Oxytocin signaling pathway
    110204990 (EGFR)
   04926 Relaxin signaling pathway
    110204990 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    110204990 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110204990 (EGFR)
   05206 MicroRNAs in cancer
    110204990 (EGFR)
   05205 Proteoglycans in cancer
    110204990 (EGFR)
   05230 Central carbon metabolism in cancer
    110204990 (EGFR)
   05231 Choline metabolism in cancer
    110204990 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110204990 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110204990 (EGFR)
   05212 Pancreatic cancer
    110204990 (EGFR)
   05225 Hepatocellular carcinoma
    110204990 (EGFR)
   05226 Gastric cancer
    110204990 (EGFR)
   05214 Glioma
    110204990 (EGFR)
   05218 Melanoma
    110204990 (EGFR)
   05219 Bladder cancer
    110204990 (EGFR)
   05215 Prostate cancer
    110204990 (EGFR)
   05213 Endometrial cancer
    110204990 (EGFR)
   05224 Breast cancer
    110204990 (EGFR)
   05223 Non-small cell lung cancer
    110204990 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110204990 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110204990 (EGFR)
   05171 Coronavirus disease - COVID-19
    110204990 (EGFR)
   05163 Human cytomegalovirus infection
    110204990 (EGFR)
   05165 Human papillomavirus infection
    110204990 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110204990 (EGFR)
   01522 Endocrine resistance
    110204990 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110204990 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110204990 (EGFR)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110204990 (EGFR)
Protein kinases [BR:pcw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   110204990 (EGFR)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110204990 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   110204990 (EGFR)
  Exosomal proteins of bladder cancer cells
   110204990 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 110204990
NCBI-ProteinID: XP_020836941
UniProt: A0A6P5JX48
LinkDB
Position
Unknown
AA seq 1213 aa
MGLYGAAGAAVLVLLAGHFSLSSALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQKNYDLSFLKTIQEVAGYVLIALNAVEKIPLENLQIIRGNVLYENFYALS
VLSNYDVNKTGVRELPMRNLLEILVGGVRFNNNPTLCNVETIQWKDIVDSAYLNNITIDN
NSHPKSCEKCDSSCPNGSCWGPGPQNCQSLTKTICAQQCSGRCRGSSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPDGKYSFGATCVRKCPHNYV
VTDHGSCVRSCNAETYEVEEDGVRKCKKCEGPCSKVCNGIGIGEFKDVLSINATNIKQFQ
NCTTISGDLHILPVAFKGDSFTNTPPLDPKELNILRTVKEISGFLLIQAWPENMTDLHAF
EHLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISKNRQLCYANTINWNKL
FGTKSQKSKITNNKDEKECRTLGHVCHELCSPDGCWGPKPSHCLSCRYVSRHKKCVEKCN
ILEGEPREYMENLKCLQCHPECLPQVMNQTCTGPGPDKCIECAHYIDGPHCVKTCPAGIM
GENDTLVWKYADANKVCQRCHPNCTYGCEGPGLEGCPTPGPKIPSIATGIVGGFLLLMVL
ILGIGLFIRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDHPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYIREHKDNIGSQYLLNWCVQIAKGMSYLEERRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGADEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIVEFSKMARDPQRYLVIQGDERMHLPSPTDSKFYRTLMEEEDMEDIVDADEYLIPQ
QGFFNSPSTSRTPLLSSLSATSNNSATVCIDRNGQICPVKEESFIQRYSSDPTTVLTEDN
VDDSFQPVPEYINQSAPKNHTGSAIQNPVYHNQPFNPDASKDSLYQNSHNSSAVDNPEYL
NTTQPNLIKKAFDGNSCWNPKANHPISLDNPDYQQDFFPQEAKPNGVFKVPAAENPEYLR
VAAQQSEFIQASA
NT seq 3642 nt   +upstreamnt  +downstreamnt
atggggctctatggggctgctggagccgctgtcctggtgctgcttgccggacacttctcc
ctgagctcggcgctggaagaaaagaaagtttgccaaggaacaagtaacaagctgacccag
ttgggtacttttgaggaccacttcctgagtctccagagaatgttcaataactgtgaggtg
gtacttggaaatttggaaatcacctatgtccaaaaaaattatgacctttccttcctaaag
accatccaggaggttgctggctatgtgctcattgctctcaatgcagtcgagaaaattcct
ttggaaaacctgcagatcatccgaggaaatgtgttgtacgaaaatttttatgccctttct
gtgctctccaactatgatgtgaataaaacaggagtgagggaactgcccatgaggaatcta
ctagaaatccttgttggtggtgttcggttcaacaataacccaaccctgtgtaatgtggag
acgatccagtggaaggatattgtggactccgcctatttaaacaatatcacaatagacaat
aacagccatcctaagagttgtgaaaagtgtgattctagttgtcccaatggaagctgttgg
ggtcctggaccacaaaattgccagagtttgacgaagaccatctgtgcccagcagtgctca
ggacggtgtcgcggtagttcccccagtgactgttgccacaaccagtgcgcagcaggttgt
actggaccccgagagagtgactgcttggtctgtcgaaagtttcgagatgaagccacatgc
aaagacacctgcccccctctgatgctatacaaccccaccacataccagatggatgtcaac
ccagacggcaaatacagctttggagccacctgtgtacgcaagtgcccacataactatgtg
gtgacagaccatggttcttgtgttcgctcctgtaatgctgagacctatgaagtggaggaa
gatggcgtccgaaaatgtaaaaagtgtgaaggtccatgtagtaaagtttgcaatggaata
ggaattggtgaatttaaagatgttctctccatcaatgccacaaacatcaaacaattccag
aattgtaccaccatcagcggcgatctgcacatcttgcctgttgcatttaaaggtgactcc
ttcacgaatactccacctttagatcccaaagaactgaatattctcaggaccgtgaaggaa
atatcaggatttttgctgattcaggcttggcctgaaaacatgactgacctccatgctttt
gaacatctggaaattatacgaggccgaacaaagcaacatggtcagttttctcttgctgtt
gttggcttggacataacttccttgggcttacgctccctcaaggaaatcagtgatggtgat
gtcatcatctcaaaaaacagacaactctgctatgcaaacacaataaactggaacaaactg
tttggaacaaaaagtcagaaaagcaaaatcacaaacaacaaagatgaaaaagagtgccgg
actctgggccatgtttgtcatgaattgtgctcacccgatggttgctggggtccaaagcca
agccactgcctgtcctgtcgctatgtgagccgtcacaagaagtgtgttgagaaatgtaac
attctagaaggagaaccaagggagtacatggagaatctgaaatgtctgcagtgccaccct
gagtgtctgcctcaggtgatgaatcaaacctgcacaggaccgggtcctgacaaatgcata
gaatgtgctcactatatagatggtccacactgtgtcaagacttgtccagctggaatcatg
ggagaaaatgataccttggtctggaaatatgctgatgcaaataaggtttgccaacgatgc
catcccaattgtacctatgggtgtgaaggtccaggtcttgaaggctgtcccacacctggc
cccaagatcccttccatagccactggaattgtgggtggctttctcttactgatggtgttg
atccttggcatcggtctcttcattagaaggcgccatattgtccgcaaacgcacgctgcgc
aggctactgcaagaaagggagctagtcgagcctctcacccccagtggagaagctcccaac
caggctcttttacggatcctaaaggagacagaatttaaaaagatcaaagtgcttggctct
ggagctttcggcacagtgtataagggactatggattccagaaggagagaaggtgaagatt
cctgttgccattaaagaattaagggaagctacttctccaaaagccaataaggaaattctt
gatgaagcctacgtgatggccagtgtggaccatccccatgtgtgccgtctcctgggaatc
tgtctcacttccacagtccaactcataacacagctcatgccattcggttgccttctggac
tacatacgggaacacaaggacaacattggctcccagtaccttctcaactggtgtgtgcag
attgccaaggggatgagttatctagaagagcgccgcttggtacaccgtgacttagcagcc
agaaatgtccttgtgaagacacctcaacatgtgaagatcacagattttgggctggcaaag
ctgcttggtgctgatgagaaagaataccatgcagaaggaggcaaggtgcctattaaatgg
atggctttggaatcgattttacaccgtatttatacccaccaaagtgacgtctggagctat
ggtgtcacagtttgggagctgatgacatttgggtccaaaccttacgatggaatccctgca
agtgaaatttcatctattttagagaaaggagaacgccttcctcagccacccatctgcacc
attgatgtctacatgatcatggtcaaatgctggatgatagatgctgacagtcgccccaag
tttcgtgagttgattgtagaattttctaaaatggcccgtgatccccagcgctaccttgtt
atacagggagatgaaagaatgcacttgccaagtcccacggactccaaattttatcgcacc
cttatggaagaggaggacatggaagatattgtagatgcagatgagtaccttattccacag
caaggattcttcaacagcccctccacatctcgcacacctctcctaagctctctgagtgct
accagcaataattctgccacagtatgcattgatagaaatgggcagatttgccctgtgaag
gaagaaagctttatccagagatacagttctgatcccactactgtcttaactgaagacaat
gtggatgatagcttccagcctgtaccagaatatataaaccagtcggctcctaaaaaccac
acgggttctgccatccagaaccctgtctatcacaaccagcctttcaacccagatgcctct
aaagactctctgtaccaaaactcacacaacagcagtgcggtggacaaccctgagtatctc
aacacaacccagcccaacctgatcaaaaaagccttcgacggcaattcctgctggaacccg
aaagccaaccacccaatcagtctggacaaccctgactaccagcaggacttcttcccccag
gaagccaagccaaatggggtttttaaagttcctgccgcagaaaatcctgagtacctcagg
gtagcagcacaacaaagtgaattcattcaagcttcagcatga

DBGET integrated database retrieval system