KEGG   Phascolarctos cinereus (koala): 110205341Help
Entry
110205341         CDS       T05867                                 

Gene name
CARD9
Definition
(RefSeq) caspase recruitment domain-containing protein 9 isoform X1
  KO
K12794  caspase recruitment domain-containing protein 9
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04621  NOD-like receptor signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw05152  Tuberculosis
pcw05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110205341 (CARD9)
   04625 C-type lectin receptor signaling pathway
    110205341 (CARD9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110205341 (CARD9)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110205341 (CARD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2
Motif
Other DBs
NCBI-GeneID: 110205341
NCBI-ProteinID: XP_020837553
LinkDB All DBs
Position
Unknown
AA seq 488 aa AA seqDB search
MSDYENDEECWNMLESFRVKLISVIDPSRITPYLRQCKVINLDDEEQVLNDPNLVIRKRK
VGVLLDILQRTGHNGYVAFLESLELYYPQLYKKVTGKEPTRVFSMIIDASGESGLTQLLM
NEVMKLQKKVHDLSVMLSAKDDFIKEMRVKDSMLRKHQERVQKMKDDCEAFSRELKRCKD
ENYDLAMLYARQSEEKNTALMRNRDLQLEIDRLKHNLMKAEDDCKVERKHTMKLRHAMEQ
RPSQEVMWEIQQEKDLLQAKVQELESSMKSIEEKEMFELQGMALRKDSKMYKERIEAILQ
QMEEVAIERDQAIMTREEFHLQHSNSLKEKDELRKQIRELGEKYDELQLRLFKKEGQVLS
MESKLKRLQSETPILSSDLDDSSPRNSQELTLPRDLEEDAQLSNKNHPAKERLLEQPFAT
TKEKLFLAQNGGGLSNGDPQEKERRRIKESFENYRRKWAHRKVHRRTRQGEVDWENTTGS
DNTDTEGS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtcagactatgaaaatgatgaggaatgttggaatatgctcgagagctttcgggtgaag
cttatctccgtcattgacccttccaggatcacaccatacctccgacagtgtaaggtcatt
aaccttgatgacgaggaacaagttctcaatgatcctaacctggtcattcgaaaaaggaaa
gtaggtgttcttttggacatcctccaaaggactggtcacaatgggtatgtggccttcctg
gagagtctagaactttattacccacagctatataagaaagtcactgggaaggaacccacc
agggtcttctccatgataatagatgcttctggggagtcaggcctgacacagctgctcatg
aatgaagtcatgaagctgcagaagaaggtgcacgatctgagcgtgatgctgagtgccaaa
gatgactttatcaaggaaatgcgggtgaaggacagcatgctacgtaagcaccaggaacgg
gtgcagaagatgaaggatgattgtgaggcctttagccgggagctcaagaggtgcaaggat
gagaactatgacttggccatgctctacgccaggcagagtgaggaaaaaaacactgcactc
atgagaaaccgtgaccttcagcttgagatagaccgactaaagcacaacctgatgaaggct
gaggatgactgcaaggtagagaggaagcacacgatgaaactcaggcatgctatggagcag
aggccaagtcaggaggttatgtgggagatccagcaggagaaggatcttcttcaagcaaag
gtccaagaactggagagctccatgaagagcatagaagagaaggagatgtttgagctgcag
ggcatggccctgcgtaaggattccaagatgtacaaagaacgcattgaagctatcttgcag
cagatggaggaagtagctatagaaagggaccaggccatcatgacaagggaggagttccac
ctgcagcattcgaatagcctgaaggagaaggacgagctccggaagcagatccgggagctg
ggtgaaaagtatgatgagctgcagttacggctgtttaagaaagaggggcaggtactgtcc
atggagagcaagctgaagcggctgcagtcggagacgcccattctgagttcagacttagat
gacagctcgcccaggaattctcaggagttaactcttcccagggacctggaggaggatgca
cagctctccaacaaaaatcatccagctaaggagaggctcctagaacagcccttcgccacc
acaaaggagaagctttttctggcccaaaatggaggtggactgagcaatggggatccacaa
gagaaggaacggcgccgtattaaagaaagctttgagaactatcgtaggaagtgggcacat
agaaaggttcaccgtagaacccggcagggagaagtagactgggaaaacaccacaggaagt
gacaacacagatacggagggctcctaa

DBGET integrated database retrieval system