KEGG   Phascolarctos cinereus (koala): 110205362Help
Entry
110205362         CDS       T05867                                 

Gene name
COL5A1
Definition
(RefSeq) collagen alpha-1(V) chain isoform X1
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    110205362 (COL5A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110205362 (COL5A1)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   110205362 (COL5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 110205362
NCBI-ProteinID: XP_020837577
LinkDB All DBs
Position
Unknown
AA seq 1836 aa AA seqDB search
MDAHTRWKRRSWIRDCPLLVATFLLSAVWPSHAAQPADLLKVLDFHNLPDGITKTTGFCA
SRKSSKGPDVAYRVTKDAQLSAPTKQLYPASSFPEDFSILTTVKAKKGNQAFLVSIYNEQ
GIQQIGLEMGRSPVFLYEDHMGKPGPEDYPLFRGINLSDGKWHRIAISVQKKNVTLVLDC
KKKTTKFLDRSDHPIIDVNGIIVFGTRILDEEVFEGDIQQLLIIPDARAAYDYCEHYSPD
CDTAVPDTPQSQDPNPDEYYPEGEGDGETYYYEYPYYEDPDDPGKTPTPTKKPVEAAREA
TEVAEEQTPPPTDAPPVPETNEGDDKEDPNLGGSDYEYGPINEEYYTPPPYEDIYESVDS
PDQPTDPVGGAEIPTSTVIITNSTNTGPFPDPDPGRDDIDNDFAVETIKDLENYYDPYFD
PTISPSEIGPGMPANQDTIYEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLPGP
PGTAGPTGQVGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFGGGGDAGSKGPLVSAQ
ESQAQAILQQARLALRGPAGPMGLTGRPGPVGPPGSGGLKGETGDMGPQGPRGVQGPPGP
AGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDPGPSGPPGSPGDDGE
RGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVTGMDGQTGPKGNVGPQGEPGPPGQ
QGNPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQGPPGP
QGPIGYPGPRGVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGEDGP
EGPKGRGGPNGDPGPLGPAGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGGRGT
PGKPGPRGQRGPTGPRGERGPRGITGKPGPKGNSGGDGPSGPPGERGPNGPQGPTGFPGP
KGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPGPPGP
PGEQGLPGLAGKEGTKGDPGPAGIPGKDGPPGLRGFPGDRGLPGPVGALGLKGNEGPPGP
PGPAGSPGERGPAGAAGPIGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGIQGPVGL
PGPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPIGPQGPIGQPGPSGGDGEPGP
RGQQGLFGQKGDEGPRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPSGP
PGADGPQGPPGGIGNPGAVGEKGEPGESGEPGLPGEGGLPGPKGERGEKGESGPSGAAGP
PGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPTGE
PGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLRGI
PGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQGEKGD
RGLPGPQGSSGPKGEQGITGPSGPLGPPGPPGLPGPPGPKGAKGSSGPTGPKGEAGHPGP
PGPPGPPGEVIQPLPIQASRTRRNIDASQLLDDGNGENYMDYADGMEEIFGSLNSLKLEI
EQMKHPLGTQHNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGETCIF
PDKKSEGARITSWPKENPGSWFSEFKRGKLLSYVDSEGNPVGVVQMTFLRLLSASARQNI
TYNCYQSVAWQDATTGSYDKAIRFLGSNDEEMSYDNNPYIRALMDGCATKKGYQKTVLEV
NSPKVEQVPIVDIMFNDFGEASQKFGFEVGPACFMG
NT seq 5511 nt NT seq  +upstreamnt  +downstreamnt
atggacgcccacacacggtggaaacggcgaagctggatacgcgactgcccgctcctggtc
gccaccttcctcctctccgccgtctggccgagccacgcagctcaaccagcagatctctta
aaggtattagatttccacaatttgcctgatgggataacaaaaacaacaggtttctgtgca
agcagaaaatcttccaaaggaccagatgttgcttaccgagttacaaaagatgctcaactc
agtgcacccaccaagcagctgtatcctgcttcatcatttcctgaggacttctccattcta
accactgtaaaagccaaaaaaggcaaccaggccttcctggtctccatttataatgagcag
gggatccaacagattggcctggagatgggcaggtctcccgtcttcctctatgaggaccac
atggggaaacctggaccagaggactatccactcttcaggggcattaacttatcagatggc
aagtggcacagaatagctattagtgttcaaaagaaaaatgtgactttggtattggactgt
aaaaagaagacaaccaagttcttggaccggagtgaccaccccatcattgatgtcaatggg
atcattgtatttggcaccaggatcctggatgaggaagtgtttgagggtgatatccagcag
ctccttatcatccctgacgccagagcagcttatgattactgcgaacattacagcccggat
tgtgatactgctgttccagacaccccacagtctcaggaccccaacccagatgaatattat
ccagaaggagagggagatggtgagacatattactatgaatatccgtactatgaagaccct
gatgacccaggaaaaaccccgacccccactaaaaagcctgttgaagctgctagagaagcc
acagaagttgctgaggagcagactccacccccgacagatgcaccaccagttcctgaaacc
aacgaaggggacgataaggaggacccaaacctgggagggagtgactacgagtatggaccc
atcaacgaggaatactacacaccacccccttatgaggatatctatgagagcgttgatagt
cctgaccagcccaccgaccctgttggaggagctgagattcccaccagcactgtgatcatc
accaactccaccaatactggaccatttccagacccagatccaggcagagatgacatagat
aatgattttgctgtggaaactattaaggaccttgaaaattactatgatccctattttgat
cccaccatctccccatcagagattggaccagggatgcctgcaaaccaagatacaatctat
gaagggattggaggaccccgaggtgagaaaggacaaaagggagagcctgcaatcattgag
ccaggaatgcttattgaaggcccccctggcccagaaggccctgctgggcttccaggacct
ccagggactgctggaccaacaggtcaagtgggtgatccaggagagaggggtcctcctggc
cgcccaggccttcctggagctgatggtctgccaggacctccagggaccatgcttatgctg
cctttccgatttggagggggcggtgatgcagggtcaaaaggaccattggtctcagcccag
gagtcacaagctcaagccattctacagcaggccaggttggcactaaggggtccagcaggc
ccaatgggtcttaccgggagaccaggtcctgtgggtcctcctgggagcggtggtttaaag
ggagagacaggagatatgggacctcagggtcctcgtggtgtccaaggcccacctggacca
gcaggaaagcctgggagaaggggacgagctgggagtgatggtgctaggggaatgcctgga
caaactggacccaagggtgaccgtggttttgatggattggctggtttgcctggagagaag
ggacataggggtgatcctggtccttcaggtcccccaggttctccaggagatgatggtgaa
agaggtgatgatggagaggttggacccagaggtctacctggagagcctggacctcgtggt
ttgcttggaccaaagggcccacctggcccacctggaccccctggtgtaacgggcatggat
ggacaaactggcccaaagggaaatgtgggtcctcagggtgaacccggccccccaggacaa
cagggtaatccaggtgcccagggtcttccaggtcctcagggtgcaattggtccaccagga
gaaaaaggccccttaggtaaacctgggcttccaggaatgcctggcgcagatggacctcct
ggacatcctggcaaagaaggccctccaggggagaaaggtggtcagggcccacctggtccc
cagggtccaatcggatatccgggccctcgaggagtcaagggggcagatggtatccgtggt
ttgaaaggcaccaagggtgaaaagggtgaagatggctttcctggatttaaaggtgacatg
ggcattaagggagaccgaggtgagattgggccacctggacctagaggagaagatggccca
gaaggcccaaaaggtcgtggtggtcctaatggggacccaggcccccttggtcctgctgga
gaaaagggaaaacttggagtcccaggcttaccaggctacccaggaagacaaggtccaaag
ggttctattggatttcctggcttccctggagcaaatggagagaagggtggaaggggaaca
cctggaaaaccaggaccgagaggacaaagaggtccaacgggcccacgtggtgaaagaggt
ccaagagggatcactggtaaacctggacctaagggcaattctggtggtgatggcccatct
ggtcctcctggagaacggggacctaatggacctcaaggacccacaggatttcctggacca
aaaggccctcctggtcctccagggaaggatggacttcccggtcacccgggacagagaggt
gaaactggcttccaaggcaagactggtcctccaggcccgccaggtgttgttggcccccag
ggccccactggagaaactggcccaatgggagaacgtggtcatcctggcccacctggccct
ccaggtgagcagggtcttccaggccttgctggaaaggaaggaactaagggtgatccaggc
cctgctggcatccctgggaaagatggtcctccaggcttgagaggattccctggtgatcga
ggtctccctggcccagtgggagccctcggattgaaaggcaatgaaggtcctcctggtccc
ccaggtccagcgggatctccaggtgaaaggggcccagctggtgctgctggaccaattggc
cttcctggcagacctggaccccaaggcccacctgggcctgctggtgagaaaggtgcccct
ggtgagaaaggtcctcaagggccagctggccgagatggaattcaaggtcctgtagggctc
cctggcccagcaggtcccgtgggcccacctggagaagatggagataagggtgagattgga
gagccagggcagaagggaagcaaaggagacaaaggtgaacagggcccaccaggtcctata
ggtcctcaaggccccattggacagcctggcccctctggaggtgatggagagccaggtcca
cggggccagcaaggtctttttgggcagaaaggtgatgaaggtccaagaggttttcctggt
cccccagggccagttggattgcagggcttaccaggacccccaggtgagaaaggagaaacg
ggagatgtcggtcagatgggccctcctggtccccctggtccccgaggaccatctggccct
ccaggagctgatggtccccaaggtcctccaggaggaataggaaatcctggagcagtggga
gaaaagggtgagcctggtgaatctggtgaacctggccttccaggtgaaggtggtctcccg
ggacccaaaggagaaagaggagaaaagggtgaatcaggtccgtccggtgctgcaggacct
cctgggcccaaaggccctcctggtgatgatggaccgaaaggcagccctggccctgttggt
ttccctggtgatcctggtccccctggagaacctggtcctgcgggtcaagatggtccacca
ggtgataaaggagatgatggtgaacctggtcaaactggatccccaggccctactggtgaa
ccagggccatctggacctccaggaaaaaggggtcctcccggaccagctggccctgaagga
agacaaggagagaaaggagccaagggtgaagctggcttggagggcccacctggaaagact
ggtccaattggtccccaaggtgcaccaggaaagcctggtcctgatggccttcgagggatt
ccaggccctgtgggagaacaaggtctaccaggatctcctgggccagacggtccccctggc
cccatgggtcccccaggccttccaggtctgaagggagattcaggtcccaaaggtgaaaag
ggtcatccaggtttgattggtcttattggacctcctggtgagcagggtgaaaaaggtgac
cgaggtcttcctggacctcagggttcatcaggtcctaaaggagaacagggtataactggt
ccttctggtccccttggtccccctggacctcctggtttaccaggccctcctggtcccaaa
ggtgctaaaggttcttcgggtccaacaggtcccaaaggagaggccggccaccctgggcct
cctggtccacccggtcctccaggtgaagtcattcagccattgcccattcaggcttctagg
acccgacggaacattgatgccagccagttgcttgatgatggtaatggtgagaactacatg
gattatgccgatggtatggaagagatctttggctcactcaactctttgaaactggaaatt
gagcagatgaagcatcccttaggtactcagcacaatcctgctcgtacctgcaaagacttg
cagctctgccaccctgacttccctgatggtgaatattgggttgacccgaaccaaggatgc
tccagggattctttcaaagtttactgcaatttcacagctggtggagaaacttgcatcttc
cccgataagaaatcagaaggagccagaattacttcctggcccaaggaaaacccaggctcc
tggttcagtgaattcaagcgtggtaaactgctctcctacgtggactcagaggggaatcca
gtcggagtggtacagatgacattcctcaggctcctcagtgcttctgcacgtcagaacatc
acttacaactgctaccagtcagtcgcctggcaagatgccaccacgggcagctatgacaaa
gccattcgcttcttgggctccaatgatgaagagatgtcctatgacaacaacccttacatc
cgagctctcatggatggctgtgcaacaaagaaaggctaccagaagacggttctcgaagtc
aactcccccaaagtggaacaagtacctattgtggacattatgtttaatgacttcggtgaa
gcctcacagaaatttggattcgaagtgggaccagcttgcttcatgggttaa

DBGET integrated database retrieval system