KEGG   Phascolarctos cinereus (koala): 110206051
Entry
110206051         CDS       T05867                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2 isoform X1
  KO
K09389  transcription factor E2F2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw04110  Cell cycle
pcw04218  Cellular senescence
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05206  MicroRNAs in cancer
pcw05212  Pancreatic cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110206051 (E2F2)
   04218 Cellular senescence
    110206051 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110206051 (E2F2)
   05206 MicroRNAs in cancer
    110206051 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110206051 (E2F2)
   05225 Hepatocellular carcinoma
    110206051 (E2F2)
   05226 Gastric cancer
    110206051 (E2F2)
   05214 Glioma
    110206051 (E2F2)
   05220 Chronic myeloid leukemia
    110206051 (E2F2)
   05218 Melanoma
    110206051 (E2F2)
   05219 Bladder cancer
    110206051 (E2F2)
   05215 Prostate cancer
    110206051 (E2F2)
   05224 Breast cancer
    110206051 (E2F2)
   05222 Small cell lung cancer
    110206051 (E2F2)
   05223 Non-small cell lung cancer
    110206051 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110206051 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110206051 (E2F2)
   05161 Hepatitis B
    110206051 (E2F2)
   05160 Hepatitis C
    110206051 (E2F2)
   05163 Human cytomegalovirus infection
    110206051 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110206051 (E2F2)
   05169 Epstein-Barr virus infection
    110206051 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110206051 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110206051 (E2F2)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110206051 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 110206051
NCBI-ProteinID: XP_020838720
UniProt: A0A6P5K0X8
LinkDB
Position
Unknown
AA seq 354 aa
MSIILLQPLEGFKAKRKLDLEGMGRQGLSEFRTPKGKCSRGEGLPSPKTPKSPGEKTRYD
TSLGLLTKKFIYLLSESEDGVLDLNWAAEVLEVQKRRIYDITNVLEGIQLIRKKAKNNIQ
WVGRGMFEDPVGPRKQQTLGQELKELSNMERALDQLIQNCTLDLKNLTEDETNQRLAYVT
YQDIRAIGNFKDQTVIAVKAPPETRLEVPDLREDNLQIYLKSTNGPIEVYLCPEESREAG
SPSQEAARSGPGPFTGLSSSPSSSCGPDLIAPPAVALKSQPSQALLEVNEGLLDLPHPLL
QQTEDQLLSSSLSGSPLVTFSPPLDEEDYLWGLDGGEGVSDLFESYDLGDLLRD
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtctataatactgctgcaaccacttgagggtttcaaggccaagaggaaattggatctg
gaggggatgggacggcagggactctctgagttccggacacccaaggggaagtgcagcaga
ggagaaggcctcccgagccccaagacccccaagtccccaggtgagaaaacaaggtatgac
acatcgctggggctactcaccaagaagttcatttacctgctgagcgagtcggaggatggg
gtcctggacctgaactgggcggccgaggtgctggaagtccagaagcggcgcatctatgac
atcaccaacgtgttagagggcattcagctcatccgcaagaaggccaagaacaacattcag
tgggtaggcaggggaatgtttgaagacccagttgggccccgcaagcagcagaccctgggc
caagaactgaaggagctcagcaacatggagcgggccttggaccagctgattcagaactgc
accttggatctgaagaacctcacggaggacgagaccaaccagagattggcctatgtaacc
taccaggacatccgggctataggaaatttcaaggaccagacggtgattgccgtcaaggcc
cctcctgagactcgcctggaagtccccgacctgagggaggacaacctccagatttatttg
aagagtaccaatggacccatcgaagtgtacctgtgcccggaggagagtcgggaggcaggc
agtccctcccaggaggctgcccgctctggcccaggccccttcacgggcctgtccagcagc
cctagcagctcttgtggcccggatctcattgcacccccagctgtggctctgaagtcccag
ccgtcccaggccctgctggaggtgaatgaaggcctcttggacctgccccacccgctcctg
cagcagaccgaggaccagctcctgtcctcgtccctgagcggctcgcctctggtcaccttc
tccccacccctggatgaggaggactacctgtggggcctggatggcggggagggggtcagc
gacctctttgaatcctatgacctgggagacctgctgagggactaa

KEGG   Phascolarctos cinereus (koala): 110208713
Entry
110208713         CDS       T05867                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw04110  Cell cycle
pcw04218  Cellular senescence
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05206  MicroRNAs in cancer
pcw05212  Pancreatic cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110208713 (E2F3)
   04218 Cellular senescence
    110208713 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110208713 (E2F3)
   05206 MicroRNAs in cancer
    110208713 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110208713 (E2F3)
   05225 Hepatocellular carcinoma
    110208713 (E2F3)
   05226 Gastric cancer
    110208713 (E2F3)
   05214 Glioma
    110208713 (E2F3)
   05220 Chronic myeloid leukemia
    110208713 (E2F3)
   05218 Melanoma
    110208713 (E2F3)
   05219 Bladder cancer
    110208713 (E2F3)
   05215 Prostate cancer
    110208713 (E2F3)
   05224 Breast cancer
    110208713 (E2F3)
   05222 Small cell lung cancer
    110208713 (E2F3)
   05223 Non-small cell lung cancer
    110208713 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110208713 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110208713 (E2F3)
   05161 Hepatitis B
    110208713 (E2F3)
   05160 Hepatitis C
    110208713 (E2F3)
   05163 Human cytomegalovirus infection
    110208713 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110208713 (E2F3)
   05169 Epstein-Barr virus infection
    110208713 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110208713 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110208713 (E2F3)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110208713 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 110208713
NCBI-ProteinID: XP_020842490
UniProt: A0A6P5KAK3
LinkDB
Position
Unknown
AA seq 462 aa
MRKGIQPALEQFLVTAGGGEGAAAVAAAAAAAASMDKRALLASPGFPATAAPGTYIQILT
TNSTTTSSSCSSSLQSGGAAAGPQHTNIPGVEQTAGSLLYSTPHGPSSRAGLLQQQPALG
RGGGGGPPAKRRLELGESGHQFLSDGLKTPKGKGRAAVRSPDSPKTPKSPSEKTRYDTSL
GLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMG
CSLSDDGGMLAQCQGLSKEVTELSQEEKKLDDLIQSCTLDLKLLTEDSENQKLAYVTYQD
IRKISGLKDQTVIVVKAPPETRLEVPDPLESLQIHLSSNQGPIEVYLCPEENETHSPVKS
YNQDHNGNIPKSSSKDLASTNSGHADCSISMANLSPLASPTNLLQQTEDQIPSNLEGPFV
NLLPPLIQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccaacccgccctggagcagttcctggtgaccgccgggggtggggag
ggggcggccgccgtcgccgccgccgccgctgctgcagcctccatggacaaaagggcattg
ctggccagccccggcttccccgccaccgccgcccccggcacttacatccagatcctcacc
acgaacagtaccaccacctcctcctcctgttcctcctcccttcaaagtgggggtgctgcc
gccggcccccagcacactaacatccccggcgtggagcagaccgccggcagcctcctctac
tccaccccgcacggaccctccagccgagccgggctgctgcaacagcaaccagccttagga
cgaggcggcggtggcggccctccggcaaagcgaaggctggaactaggagaaagtggtcat
cagtttctctcagatggtctcaaaacccccaaaggcaaaggaagagccgcagtaagaagt
ccagatagtccaaaaactccaaaatctccctcagaaaaaacacggtatgatacgtcactt
ggtctgctcaccaagaagttcattcagctgttgagccaatccccagatggggtcttggat
ttgaacaaggcagccgaagtgcttaaggtgcaaaagaggaggatttatgatatcaccaat
gtgctggaaggcatccacctcattaagaagaaatctaaaaacaacgtacagtggatgggc
tgcagtctctctgatgatgggggcatgctggctcagtgtcaaggtttgtcaaaggaagtg
acggagctcagtcaggaagagaagaagcttgatgacctgattcaaagctgcaccctggac
cttaagctgttaacagaagattcagaaaatcaaaaattagcttatgttacatatcaagat
atccgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaa
acaagacttgaagtgcctgatcccttagagagcctacaaatacatttatcaagtaaccaa
ggacccattgaagtttacctgtgtccagaagagaatgaaacacacagtccagtaaaatcc
tacaaccaagaccacaatgggaatattcccaaatccagttccaaagacttggcgtcaacc
aactcaggacatgctgattgctccatttctatggcaaacctttctcccttggcttctcca
actaatcttctccagcagactgaggaccaaattccttcaaacctagaaggaccatttgtg
aacttactgcctcccttgatccaagaagactaccttctcagccttggggaagaagaaggc
atcagtgatctcttcgatgcttatgatttagaaaaacttccattggtagaggactttatg
tgcagttga

KEGG   Phascolarctos cinereus (koala): 110216806
Entry
110216806         CDS       T05867                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw04110  Cell cycle
pcw04137  Mitophagy - animal
pcw04218  Cellular senescence
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05206  MicroRNAs in cancer
pcw05212  Pancreatic cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110216806 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    110216806 (E2F1)
   04218 Cellular senescence
    110216806 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110216806 (E2F1)
   05206 MicroRNAs in cancer
    110216806 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110216806 (E2F1)
   05225 Hepatocellular carcinoma
    110216806 (E2F1)
   05226 Gastric cancer
    110216806 (E2F1)
   05214 Glioma
    110216806 (E2F1)
   05220 Chronic myeloid leukemia
    110216806 (E2F1)
   05218 Melanoma
    110216806 (E2F1)
   05219 Bladder cancer
    110216806 (E2F1)
   05215 Prostate cancer
    110216806 (E2F1)
   05224 Breast cancer
    110216806 (E2F1)
   05222 Small cell lung cancer
    110216806 (E2F1)
   05223 Non-small cell lung cancer
    110216806 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110216806 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110216806 (E2F1)
   05161 Hepatitis B
    110216806 (E2F1)
   05160 Hepatitis C
    110216806 (E2F1)
   05163 Human cytomegalovirus infection
    110216806 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110216806 (E2F1)
   05169 Epstein-Barr virus infection
    110216806 (E2F1)
   05165 Human papillomavirus infection
    110216806 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110216806 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110216806 (E2F1)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110216806 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP B-block_TFIIIC
Other DBs
NCBI-GeneID: 110216806
NCBI-ProteinID: XP_020854458
UniProt: A0A6P5L8W5
LinkDB
Position
Unknown
AA seq 438 aa
MALDGSGGGGGTCVAELEALLGAGGLQLLEQQIVIISTQDEGPLSAAAVPVTAEGPREAE
LLLFATPQAPRPGASGPRPALGRPPVKRKLDLETDHQYIAEGSQPARARPRPPGKGVKSP
GEKSRYETSLNLTTKRFLELLNQSTDGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLITK
KSKNHIQWLGNHSVAINASKHQMLAKDLHHLQEAERQLDDLIQMCTVQLKLLTEDADNQH
LAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAADPAEAYQISLKSSRGPIDVFLCPEES
ADVCSPVKSPSKAPPEETGLSLEPSPPPQPPPPSPASPLTTSTQEGTLPLLASEQEHLLS
RASPASLRASAEDGRLSPLVSVDSLLEQVKEDFSSLLPDEFISLSPPQGQDYHFGLEEGE
GIRELFDCDFGDFTPLDF
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggccctggacggcagcggtggcggtggcggcacgtgcgtggcggagctggaggccctg
ctgggggctggggggctgcagctgctggagcagcagatcgtcatcatctccacgcaggac
gaaggcccgctcagcgccgccgccgtccccgtcaccgccgaggggccccgagaggccgag
ttgctgctgttcgctacgccccaggctccccggcccggagccagcggacccaggcctgcc
ctgggccggcctccggtgaaaaggaaactggacttggaaacagaccatcagtacatagct
gaaggcagccagccagcccgggccaggcccagaccccctggcaaaggtgtgaagtcccca
ggggagaagtctcgctatgagacctcactgaacttgaccaccaaacgcttcctggagttg
ctgaaccagtctacagatggtgtggtggacctgaactgggcagcggaggtgctgaaggtg
cagaaacggcgcatctatgacatcaccaatgtgctcgaaggcatccagctcatcaccaag
aagtccaagaaccacatccagtggctggggaaccattctgtagccatcaacgccagcaag
caccagatgctagccaaggacttgcatcatctccaggaggctgagaggcagctggatgac
ttgatccagatgtgcaccgttcagctcaaactgctcactgaagacgccgacaatcagcac
ttagcctatgtaacctgccaagacctacgcagtatagcagaccctgcagagcagatggtg
atggtgattaaggccccaccagagacacagctgcaggcggcagacccagcagaggcatac
cagatctctctgaaaagcagccgagggcccatcgatgtgttcctgtgccctgaggaaagt
gctgatgtgtgcagtccagtgaagagtcccagtaaagcacctcctgaggagactggcctc
agtctggagcccagccctccaccgcagccgccgccaccatcccctgccagccccctcaca
acctcaacgcaggaaggcaccttgccactgcttgccagtgagcaagaacacctcctgtcc
cgggcaagcccagcatccctcagagcctcagcagaagatggacgcctatccccactagtg
tctgtggacagcctcctggagcaggtgaaggaggatttctccagtctcctgccagatgag
ttcatcagcctctcccctccacagggccaggactaccactttggcctggaggaaggagag
ggcatcagagagctctttgactgtgactttggggactttacccccctggatttctga

DBGET integrated database retrieval system