KEGG   Phascolarctos cinereus (koala): 110206875
Entry
110206875         CDS       T05867                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00590  Arachidonic acid metabolism
pcw01100  Metabolic pathways
pcw04064  NF-kappa B signaling pathway
pcw04370  VEGF signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04657  IL-17 signaling pathway
pcw04668  TNF signaling pathway
pcw04723  Retrograde endocannabinoid signaling
pcw04726  Serotonergic synapse
pcw04913  Ovarian steroidogenesis
pcw04921  Oxytocin signaling pathway
pcw04923  Regulation of lipolysis in adipocytes
pcw05010  Alzheimer disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05140  Leishmaniasis
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05200  Pathways in cancer
pcw05204  Chemical carcinogenesis
pcw05206  MicroRNAs in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110206875 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110206875 (PTGS2)
   04064 NF-kappa B signaling pathway
    110206875 (PTGS2)
   04668 TNF signaling pathway
    110206875 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110206875 (PTGS2)
   04657 IL-17 signaling pathway
    110206875 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    110206875 (PTGS2)
   04913 Ovarian steroidogenesis
    110206875 (PTGS2)
   04921 Oxytocin signaling pathway
    110206875 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    110206875 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    110206875 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110206875 (PTGS2)
   05206 MicroRNAs in cancer
    110206875 (PTGS2)
   05204 Chemical carcinogenesis
    110206875 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110206875 (PTGS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110206875 (PTGS2)
   05022 Pathways of neurodegeneration - multiple diseases
    110206875 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110206875 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110206875 (PTGS2)
   05165 Human papillomavirus infection
    110206875 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110206875 (PTGS2)
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110206875 (PTGS2)
SSDB
Motif
Pfam: An_peroxidase EGF Phage_F hEGF
Other DBs
NCBI-GeneID: 110206875
NCBI-ProteinID: XP_020840079
UniProt: A0A6P5K504
LinkDB
Position
Unknown
AA seq 669 aa
MNRDAFATGGSRVISSRGELDCLKIERRPGIQLVPKRQSKSKSDWKARGLSQLAIAPPSA
VMMERIACLLAFAFLTLTLSCAANPCCSNPCQNRGICMTTGTDRYQCDCTRTGFYGENCT
SPAFLTKLKLMLKPTPDTVHYILTHFKGVWNIINNISFLRDMVMRYVLISRSHLIESPPT
YNVHYGYKSWEAFSNLSYYTRALPPVKDDCPTPMGVKGKKQLPESKEIVEKFLLRRKFIP
DPQGTNMMFAFFAQHFTHQFFKTDHHRGPAFTKALGHGVDLNHIYGENLERQHKLRLFKD
GKMKYQVIDGEVYPPLVKDTQAEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREH
NRVCDILKQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQ
HFQYQNRIAAEFNTLYHWHPLLPDTFQIKDKEYSYQQFLYNNSILLEHGISHMVESFSRQ
IAGRVAGGKNVPPAVQKVAMASIDQSRQMKYQSLNQYRKHFMLKPFSSFEELTGEKEMAA
ELEAVYGDIDSMELYPGLLVERPRPGAIFGETMVELGAPFSLKGLMGNPICSPDYWKPST
FGGDRGFEIINTASIQSLICNNVKGCPFTAFNVKDSQVTKTATINASSSNSGLDDINPTV
LLKERSTEL
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgaacagggatgctttcgcaactggcggaagccgagtcatctcatcacgtggggagctt
gattgccttaaaattgagaggcggccaggcattcagctagttccgaaacgccagagcaag
agcaagagtgactggaaagcgagaggactttcccagctggcaatcgctccgccctccgcc
gtgatgatggaaaggatcgcgtgcttgttagccttcgcgtttttaacgctgactctcagc
tgtgcagcaaacccttgctgctcaaacccatgtcaaaaccgaggtatatgtatgaccacg
ggaactgaccgataccaatgtgactgtaccaggacaggattctatggagaaaattgtaca
agtcctgcgtttctgacaaagctaaaattgatgttgaaacccactccagacacagttcac
tacatcctcacccacttcaagggagtgtggaatataatcaacaatatctcttttctgcgg
gacatggtgatgagatacgtgttgatatcaagatcacatctgattgaaagtccaccaaca
tataacgttcactatggttacaaaagttgggaagccttttctaacctctcctactacact
agagctcttcccccagtgaaagatgactgcccaactccaatgggcgtaaaaggtaaaaaa
cagcttcctgaatccaaagagattgtggaaaaatttcttctgaggaggaagtttattcct
gatccccaaggcacaaatatgatgtttgcattctttgcccaacatttcactcaccagttc
tttaagacagaccatcacagaggcccagccttcacaaaagcactgggacatggggttgat
ttaaatcatatttatggagaaaatttggaaagacaacacaaactgcggcttttcaaggat
ggaaaaatgaagtatcaggtaattgatggagaagtatatccgcccttagtgaaagatacg
caggcagaaatgatctacccacctcatgtccctgagcatctgagatttgctgttgggcaa
gaagtatttggcctggttccaggtttgatgatgtatgctacaatatggcttcgggaacat
aaccgagtgtgtgacatccttaaacaggaacatcctgaatgggatgatgagcagttgttc
cagactagcagactgatattgattggtgagactattaagattgtgattgaagattatgtc
cagcacttgagtggttatcacttcaaactgaagtttgacccagaactgctgttcaaccag
cacttccaataccaaaaccgaattgctgctgagtttaacaccctctatcactggcatcct
ctactccccgacaccttccaaatcaaggacaaagagtacagttatcagcaattcctctac
aacaactctatattactggaacatggaatttcccacatggtggaatcattctcgaggcaa
attgctggccgggttgctgggggcaagaacgttccacctgcagtacagaaagttgccatg
gcttcaatcgaccagagcagacaaatgaaataccagtctcttaatcaataccgaaaacac
ttcatgctcaagccttttagctcatttgaagaactgacaggagagaaagaaatggctgct
gagctggaagctgtctatggtgatattgattctatggagttgtatcctggtctgctagta
gaaagacctcgcccaggtgccatctttggagaaaccatggttgaacttggagcacccttc
tcactcaaaggactcatgggtaacccaatctgttcccctgactactggaagcctagcact
tttggtggagatagaggttttgaaattatcaatacagcctcaatccagtcactaatctgc
aataatgtaaagggatgtcccttcactgcattcaatgttaaagactcccaagtcaccaaa
acagcaactattaatgccagttcatcaaactctggactagatgacatcaatcccacagta
ctgctaaaagaacgttcaactgaattgtag

DBGET integrated database retrieval system