KEGG   Phascolarctos cinereus (koala): 110207171
Entry
110207171         CDS       T05867                                 

Gene name
KIF5C
Definition
(RefSeq) kinesin heavy chain
  KO
K10396  kinesin family member 5
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04144  Endocytosis
pcw04728  Dopaminergic synapse
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110207171 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110207171 (KIF5C)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110207171 (KIF5C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110207171 (KIF5C)
   05012 Parkinson disease
    110207171 (KIF5C)
   05014 Amyotrophic lateral sclerosis
    110207171 (KIF5C)
   05016 Huntington disease
    110207171 (KIF5C)
   05020 Prion disease
    110207171 (KIF5C)
   05022 Pathways of neurodegeneration - multiple diseases
    110207171 (KIF5C)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110207171 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110207171 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcw04812]
    110207171 (KIF5C)
   04147 Exosome [BR:pcw04147]
    110207171 (KIF5C)
Membrane trafficking [BR:pcw04131]
 Others
  Actin-binding proteins
   Others
    110207171 (KIF5C)
Cytoskeleton proteins [BR:pcw04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110207171 (KIF5C)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110207171 (KIF5C)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 110207171
NCBI-ProteinID: XP_020840406
UniProt: A0A6P5K6U3
LinkDB
Position
Unknown
AA seq 955 aa
MADPSECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPNTSQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDHQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSIFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKDKNKSLKNVI
QHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNMTPVVSSISTEEKQKYDEE
ITCLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAA
KDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELTQKTTTLTATQRELNQLQELS
NHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQIDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEES
QDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSR
LRDEIEEKQKIIDEIRDLNQKLQLEQEKLSCDYDKLKIEDQEREMKLEKLILLNDKREQA
REDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDSDDGGGSAAQKQKISFLENN
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGGSSAYYQK
NT seq 2868 nt   +upstreamnt  +downstreamnt
atggcggacccctctgaatgcagcatcaaagtgatgtgccggttccggcctctgaatgaa
gcggagatcctccgaggggacaaattcatccccaaatttaaaggagacgagacggtggtc
atagggcaaggcaagccctatgtctttgacagagttctaccacccaacacaagccaagaa
caggtttacaatgcttgtgctaagcaaatcgttaaagatgtactggaaggttacaatggg
actatttttgcatatggacagacctcttcaggaaaaacccataccatggaggggaagctg
catgaccatcagcttatgggaatcatcccaagaattgcacatgatatctttgatcatatt
tactctatggatgaaaacctggagtttcatatcaaggtttcctattttgagatctacttg
gacaaaataagagacttacttgatgtatccaagacaaacctggctgtacatgaagataaa
aacagagtcccatatgtaaaggggtgcacagaacgatttgtctcaagccctgaagaagtc
atggatgtcatcgatgaaggaaaagcaaatcgccatgtggctgtgacaaacatgaatgaa
cacagctctaggagtcacagcatcttcctgattaatattaaacaagagaatgtagagact
gaaaaaaaactcagtggaaagctttatctggttgacctggctgggagcgaaaaggtcagc
aaaactggagcagagggagcggttcttgatgaagctaaaaatatcaataagtctttgtct
gctctgggcaacgtgatctctgccttggcagagggaacaaaaactcatgtaccatatcga
gatagtaagatgacccggatccttcaggactctcttggagggaattgcagaaccaccatt
gtaatttgctgttctccttctattttcaatgaagctgaaaccaagtccacactgatgttt
ggacaaagagccaagaccatcaagaatacagtctctgtgaacctagaactaactgctgaa
gaatggaagaagaagtatgagaaagaaaaagacaaaaacaagagcttgaagaatgttatc
cagcatctggaaatggaactgaacagatggagaaatggagaagctgtgcctgaggatgaa
cagatcagtgctaaagaccagaagaatctggagccctgtgacaatacacccatcatagat
aacatgacccctgttgtctctagcatctccacagaggagaagcagaagtatgatgaggag
ataacctgcttgtacagacaattggatgataaggatgatgaaattaaccagcagagccag
ctggctgaaaaattaaagcagcagatgttggatcaggatgagcttttagcttccacaaga
agagattatgagaagatccaggaggagctgactcgtctccagattgagaacgaggctgcc
aaggatgaggtgaaagaggttctgcaggccctagaggagctagctgtcaattatgaccag
aagtcacaggaagtggaggacaagaccagagctaatgagcagctgactgacgagctgacc
cagaaaacgactaccttgactgctacacaaagagaattgaatcagttgcaggagctgagt
aaccatcagaaaaaacgagctacagagatcctgaatttactgctgaaggacctgggggag
attggtggcatcattggcaccaatgatgtgaagacgttagcagatgtgaatggggtgatt
gaggaggagtttactatggcccggctgtacatcagtaagatgaagtcagaggtgaaatct
ctggtgaaccggagtaaacagctggagagtgcacagattgattccaaccggaagatgaat
gccagtgaacgggagcttgcagcttgccagctgctaatctcacagcatgaagcaaaaatc
aagtctctgacagattacatgcaaaacatggagcaaaagaggagacagctggaggagtcc
caggactcactcagtgaagagctggctaagctccgtgcccaagaaaaaatgcatgaagtc
agcttccaggataaagaaaaggaacacttgacccggcttcaggatgcagaggaaatgaag
aaagcattggagcagcagatggaaagccatagggaagcccaccagaagcagctgtccaga
ctccgagatgagattgaagagaagcagaaaatcattgatgagattcgggatttgaaccag
aagctgcagctggaacaagagaaactgagttgtgattatgacaagctgaaaatagaggat
caggagagagagatgaagttggaaaagctaatattgctcaatgacaaaagggaacaagca
agagaagaccttaaaggattagaggaaactgtgtccagagaactgcagactcttcataac
cttcgtaaactcttcgtccaggatctcaccaccagagttaaaaaaagtgttgaactggac
agtgatgatggcgggggaagtgctgcccagaagcagaaaatttcctttcttgagaacaac
ttggaacaacttactaaggttcataaacagctggttcgtgataatgcagatcttcgttgt
gagcttcctaagctggagaaaagacttcgtgctacggcggagcgtgtcaaagctctggag
agtgcattgaaggaagccaaggagaatgccatgcgtgaccgcaagcggtaccaacaggag
gtagatcgcatcaaagaggctgtgagagccaagaatatggcaagaagagcccattctgct
cagattgccaagccaatccgtccaggccattaccctgcatcctctccaacagctgtacat
gccatccgaggaggaggaggcgggtcatctgcctactaccagaaataa

KEGG   Phascolarctos cinereus (koala): 110210979
Entry
110210979         CDS       T05867                                 

Gene name
KIF5A
Definition
(RefSeq) LOW QUALITY PROTEIN: kinesin heavy chain
  KO
K10396  kinesin family member 5
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04144  Endocytosis
pcw04728  Dopaminergic synapse
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110210979 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110210979 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110210979 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110210979 (KIF5A)
   05012 Parkinson disease
    110210979 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    110210979 (KIF5A)
   05016 Huntington disease
    110210979 (KIF5A)
   05020 Prion disease
    110210979 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    110210979 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110210979 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110210979 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcw04812]
    110210979 (KIF5A)
   04147 Exosome [BR:pcw04147]
    110210979 (KIF5A)
Membrane trafficking [BR:pcw04131]
 Others
  Actin-binding proteins
   Others
    110210979 (KIF5A)
Cytoskeleton proteins [BR:pcw04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110210979 (KIF5A)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110210979 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATG16
Other DBs
NCBI-GeneID: 110210979
NCBI-ProteinID: XP_020845778
UniProt: A0A6P5KJJ6
LinkDB
Position
Unknown
AA seq 1033 aa
MTESNNECSIKVLCRFRPLNQSEILRGDKFIPLFQGDDSVIIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENVETEQKLSGKLYLVDXAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSFNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLGGEESTPGGEPCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLMEKLKQQMLDQEELLVSTRGDNEKVQQELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLMDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVNEVALKDKEPDTQEADEVKKALELQMENHREAHHRQLARLRDE
INEKQKIIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSIKLQELTFLYERQEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKNAGKRNHSAQIAKPVRPGHYPVSSPTNPYGTRSPECISYTNNLFQNYQNLYLQ
AAPSATSDMYFGNSFASGGTSSSSSGNLASYQKLNMDNGNATDINDNRSDLPCGCEADEQ
AKLFPLHQETAAS
NT seq 3102 nt   +upstreamnt  +downstreamnt
atgacggagtccaacaatgaatgcagcatcaaggtgctctgtcgattcagacccctgaac
cagtcggagattctgcggggtgacaaatttatccccctttttcaaggggacgacagcgtc
attattgggggaaagccgtatgtatttgatcgagtattccctccaaacacaacacaggaa
caagtttatcatgcatgtgccatgcaaattgtcaaagatgttcttgctggttacaacggc
actatttttgcttatggacagacatcatcaggaaagacacacactatggagggaaagctg
catgaccctcaactgatgggaataattcctcgaattgcccgtgacatcttcaatcacatc
tactccatggatgagaaccttgagttccacatcaaagtttcttactttgaaatttatctg
gataaaattcgtgacctgctggatgtgaccaagacaaacctgtctgtccatgaagataag
aaccgtgtgccatttgttaagggttgcactgagcgctttgtgtctagcccagaagaaatt
ttggatgttatcgatgaggggaaatcaaaccgccacgtggcagtcactaacatgaatgag
cacagctccagaagccacagcattttccttatcaacatcaagcaagaaaacgtggagact
gagcaaaagctcagtgggaagctctatttagtggatntggcaggaagtgagaaggtcagc
aaaacaggggcagagggagccgtgttggatgaagcaaagaatattaacaagtctttgtca
gcattggggaatgtgatctctgccctggctgaaggcacaaaaagctacgttccatatcgt
gacagcaaaatgactaggatccttcaggactctttgggagggaactgccggacaaccatg
tttatctgctgctcaccatccagtttcaatgatgctgagaccaaatctactcttatgttt
ggacagagggcgaagaccatcaagaacactgcttcagtgaatttggaactgactgctgag
caatggaagaagaaatatgagaaagagaaggagaagacaaaggcacaaaaagagacaatt
gccaagctggaagctgagctaagccggtggcgaaatggggagaatgtgccagagacagag
cgtctaggtggggaggaatcaacccctggaggggagccctgtgaggagacacctgtgaat
gacaactcatccattgtggttcgaattgcacctgaggaaagacagaaatatgaagaggag
ataaggcgtctctataagcaactagatgataaggatgatgagattaatcagcagagtcaa
ctgatggaaaaacttaagcaacaaatgttggaccaagaggagctgttggtgtccacacga
ggtgacaatgagaaggttcagcaggagctgagtcatctgcagtcagagaatgatgcagcc
aaggatgaggtgaaagaggtgttgcaggcattagaggaattggcagtcaactatgatcaa
aaatcacaggaagttgaggaaaagagtcagcagaaccagctgctgatggatgaactgtcg
caaaaggtggctactatgctgtccctggaatctgagctgcagagactacaagaagtcagt
ggtcatcagagaaagagaattgctgaggtcttgaatggactaatgaaagacctgagtgaa
ttcagtgtcattgtgggcaatggggaaatcaaactgccagtggaaataagtggagcaatt
gaggaggaattcacagtggcccgactctatatcagtaagatcaagtcagaagtgaagtct
gtggttaagcgctgcaggcaactggagaatctacaggttgaatgtcaccgaaaaatggag
gtgactgggcgagagctctcctcctgtcaactgctcatatcccagcatgaggccaaaatc
cgatccctgactgaatacatgcagagtgtggaactgaaaaagaggcatcttgaagagtcc
tatgattccttgagcgatgagcttgctaaattacaggctcaggaaactgtgaatgaagta
gccttgaaggacaaggagccagacacacaggaggctgatgaggtgaagaaggcactggaa
ctgcagatggagaaccatcgtgaggctcatcaccggcagctggcccggcttcgggatgag
atcaatgagaagcagaaaatcattgatgagctgaaggacctaaatcagaagctacagctg
gagctagaaaaactgcaggctgactatgaaaagctcaagagtgaggagcatgagaagagc
attaaactacaggagctgacatttctctatgagcgacaggagcagtccaagcaggacctc
aaggggctggaggagactgttgcccgggaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggaacccgaggacagt
ggggggattcactcccagaaacagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggttcgtgacaatgcagatttgcgctgtgagcttcctaag
ctggagaaacgacttagggctacggctgagagagttaaggccctggagggcgcactgaag
gaagcaaaggaaggcgccatgaaagataagcgcagatatcagcaagaggtagacagaatc
aaggaagcagtgcgctacaagaatgctggcaagcgaaaccactctgctcagattgccaaa
ccagtccggcctggccactatccagtatcttcacccaccaatccttatggcaccaggagc
cctgaatgcatcagctacacaaacaatctcttccagaactaccagaatttgtacctgcag
gctgcacctagtgctacttcagacatgtactttggtaactccttcgccagcggtggaact
tcctcctcctccagtggtaatctggcttcctaccagaagttaaacatggataacggaaat
gccacagacatcaatgacaacaggagtgacctgccctgtggctgtgaagctgatgaacag
gctaagcttttcccccttcatcaagagacagcagccagctaa

KEGG   Phascolarctos cinereus (koala): 110211255
Entry
110211255         CDS       T05867                                 

Gene name
KIF5B
Definition
(RefSeq) kinesin-1 heavy chain isoform X1
  KO
K10396  kinesin family member 5
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04144  Endocytosis
pcw04728  Dopaminergic synapse
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110211255 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    110211255 (KIF5B)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110211255 (KIF5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110211255 (KIF5B)
   05012 Parkinson disease
    110211255 (KIF5B)
   05014 Amyotrophic lateral sclerosis
    110211255 (KIF5B)
   05016 Huntington disease
    110211255 (KIF5B)
   05020 Prion disease
    110211255 (KIF5B)
   05022 Pathways of neurodegeneration - multiple diseases
    110211255 (KIF5B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110211255 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110211255 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcw04812]
    110211255 (KIF5B)
   04147 Exosome [BR:pcw04147]
    110211255 (KIF5B)
Membrane trafficking [BR:pcw04131]
 Others
  Actin-binding proteins
   Others
    110211255 (KIF5B)
Cytoskeleton proteins [BR:pcw04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110211255 (KIF5B)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110211255 (KIF5B)
SSDB
Motif
Pfam: Kinesin Microtub_bd Crescentin ERM
Other DBs
NCBI-GeneID: 110211255
NCBI-ProteinID: XP_020846126
UniProt: A0A6P5KP24
LinkDB
Position
Unknown
AA seq 966 aa
MADPAECNIKVMCRFRPLNEAEMARGDKYVAKFQGEDTVIVASKPYAFDRVFQSSTTQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPDGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAESSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQW
LENELNRWRNGETVPVDERFDKEKANLEAFAVDKDITIINDKPAATIGVTGNFTDAERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKAKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRATEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQAESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLNEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVDAKEKLITDLQDQNQKMMLEQERLRVEHEKLKATDQEKSRKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFTQNSQPVAVRGGGG
RQDKVC
NT seq 2901 nt   +upstreamnt  +downstreamnt
atggcggacccggccgaatgcaacatcaaggtgatgtgccgcttcaggcccctcaacgag
gccgagatggcccggggcgacaagtacgtcgccaagttccagggcgaggacacggtcatc
gtggcgtccaagccttatgcatttgatcgtgtattccagtcaagcacaacacaggagcag
gtatataatgactgtgcaaagaagatagtgaaagatgtacttgaaggatataatggtaca
atatttgcatatggacagacatcctctgggaagacgcatacaatggagggtaaactccat
gatccagatggaatgggtattattccaagaatagtacaggatatttttaattatatttac
tctatggatgaaaatttggagttccacattaaggtatcatattttgaaatatatttggat
aagataagggaccttttggatgtttcaaagaccaatctttctgttcacgaggacaaaaac
agagttccctatgtaaagggttgcacagagcgttttgtatgtagtcctgatgaggttatg
gatactatagacgaaggaaaatctaacagacatgtagcagttacgaatatgaatgaacat
agctctagaagtcacagtatctttcttattaatgtaaaacaagaaaacactcaaacagaa
cagaaactgagtgggaaactttatctggtagatttggctggtagtgagaaggttagtaaa
actggagctgaaggtgctgtgctggacgaagctaaaaacatcaacaagtctctgtctgct
cttggaaatgtcatttctgctttggctgagagtagtacatatgttccctatcgagatagt
aaaatgacaagaatccttcaagattcactaggtggcaactgcagaaccactattgtcatt
tgttgctctccatcatcatataacgagtcggaaacaaaatctactctcctgtttggccaa
agagccaagacaataaagaacacagtttgtgttaatgtggagctaactgcagaacagtgg
aagaaaaaatatgaaaaagaaaaagagaaaaacaagacattacgtaacaccattcagtgg
ctagaaaatgaactcaatcgatggcgaaatggggagactgtaccagttgatgaacggttt
gacaaagagaaagccaacttagaagcctttgcagtagataaagatattactatcatcaat
gataagccagcagccacaattggagttacaggaaacttcactgatgctgaaagaagaaag
tgtgaagaagaaattgctaaattgtacaaacaacttgatgataaggatgaagaaattaat
cagcagagccagttggtagagaaattgaagacacaaatgttggatcaagaagagcttcta
gcatctaccagaagggaccaagataatatgcaggctgaactgaatcgcctgcaggcagaa
aatgatgcctccaaggaagaagtgaaagaagtgctgcaggctctggaggaacttgcagtc
aactatgatcagaagtctcaggaagttgaagacaaagccaaggagtatgagctacttagc
gatgaattgaatcagaaatcggcaactctagcaagtatagatgctgagcttcagaaactc
aaggaaatgacaaatcaccagaaaaaacgagcaacggagatgatggcctctttattgaaa
gaccttgcagaaattggaattgctgtgggaaataatgatgtcaagcagcctgaaggaact
ggcatgatagatgaagaattcaccgttgcaagactgtacattagtaaaatgaagtcagaa
gtgaaaacaatggtaaaacgctgcaaacagttagaaagcacccaagctgagagcaacaaa
aaaatggaagaaaatgaaaaagaattagcagcatgtcagcttcgtatatcacagcatgaa
gcaaaaatcaagtcattgactgaataccttcagaacgttgagcaaaagaaaaggcagttg
gaagaatctgtggactcccttaatgaagaactagtccagcttcgagcacaagaaaaagtc
cacgaaatggaaaaagagcatctaaataaggttcagactgcaaatgaagttaagcaagct
gttgaacaacagatacaaagccatagagaaactcatcaaaaacaaattagtagtctgaga
gatgaagttgatgcgaaagaaaagcttattactgatcttcaagatcagaatcagaaaatg
atgctagagcaggaacgcctgagagttgaacatgagaagttgaaagctacagaccaagaa
aaaagcaggaaactacatgaacttactgtcatgcaagacaggcgagaacaagcaaggcaa
gacctgaagggtttagaagagacagtggcaaaagaacttcagactttacacaaccttcgg
aagctctttgttcaagacctagccacaagagttaaaaagagtgcagagattgattctgat
gacactggaggtagtgctgcccaaaagcagaagatctcctttcttgagaataatcttgag
cagctcactaaagtgcacaaacagttggtacgtgataatgcagatcttcgctgtgagctt
ccaaaattggaaaaacgacttagagctacagctgagagagttaaagctttggagtcggct
ctgaaagaagccaaagaaaatgcctctcgggatcgtaaacggtatcagcaagaagtcgat
cggattaaggaagctgtcaggtcaaagaacatggccaggaggggacattctgcacagatt
gctaagcccattcgtcctggacagcatccggctgcttctccaactcatccaagtgcaatt
cgtgggggaggcgcgtttactcagaatagccaacctgtggcagttcgtggtggtggaggc
agacaagacaaagtctgttga

KEGG   Phascolarctos cinereus (koala): 110221483
Entry
110221483         CDS       T05867                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret isoform X1
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04020  Calcium signaling pathway
pcw05200  Pathways in cancer
pcw05216  Thyroid cancer
pcw05223  Non-small cell lung cancer
pcw05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    110221483 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110221483 (RET)
   05230 Central carbon metabolism in cancer
    110221483 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    110221483 (RET)
   05223 Non-small cell lung cancer
    110221483 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110221483 (RET)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110221483 (RET)
Protein kinases [BR:pcw01001]
 Receptor tyrosine kinases (RTK)
  RET family
   110221483 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD4 Pkinase RET_CLD3 Cadherin RIO1 Pkinase_fungal Cadherin_pro
Other DBs
NCBI-GeneID: 110221483
NCBI-ProteinID: XP_020861812
UniProt: A0A6P5LTF2
LinkDB
Position
Unknown
AA seq 1105 aa
MSPPGGLVGLLLLCEAALGLYFSRDTYSEKIYIDEPVGTPLLYVHALQDAQGEVPHFRLG
QHLYSSYRSQPHKNDWFQINEDTGLLYLNQSLDQRAFEKLSARSGGFPLLTIYLQVFLSP
RPFRESDCHWPSCAKVMLSIINTTMPACSSLKPREFCFLETGLSFRIRENKPPGTFHQFR
LLPVQRLCPNISISYQLLRDEDLPFHSDKDTMEVSMRHSLDREQKEKYELVAKCTVREGL
REDNVMVPFPVTVYDEDDSPPNFPTGINTANAVVEYKRKEGTVLAVLQVFDADVVPSSGD
IPRKYIHTMLTSDPRVIKFFRVEHLPNETSYNSNGSRVRAMMHDYKLVLNQSVPITENHS
FQLGVLVNDTDFQGPGGVLQLYFNVTILPVSIQFPNISYSFSVNRNAHRYAQIGKVCIEN
CKEFHGVNITYKLQSLSVNCSALSIITSPESTTGNLFVNDTSMLQRPECTGMKYDVFATD
KQSRKQSKTTLTISVEGNFSPEEEGCPISCAVNKRRLECEECGGLGTLMGTCQWRQGDGK
GISKNYSTCTPSLKTCPDGSCDAVESRDLHICPQDCIRGDVIGGHEKGEWRGIKAGYGVC
NCFPEEKKCFCEPDDDKEPLCDEVCRMVIAVAILFSFIFSVLLSSYFIRRYHKNSHKPPI
ASAEMTFRRPAQAYPISYSSSNVRRPSLDSMENQVSVDAFKIPEDPKWEFPRKNLVLGKT
LGEGEFGKVVKATAFRLKGKTGYTTVAVKMLKENASPSELKDLLSEFNLLKQVNHPHVIK
LYGACSQDGPLYLIVEYAKYGSLRSFLRESRKVGPSYMGGNGNRNSTYLDNPDERALTMG
DLISFAWQISRGMHYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRS
KGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGYR
MERPENCSEEMYNLMLHCWKQEPDKRPIFGEISKDLEKMMVKSRDYLDLAASTPSDSLLY
DDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGMSYPNWPEESPVPLTRFDGTNSVFSR
YANDSVYANWMVSPSAAKLMDKFNS
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgtctccccccggggggctcgtggggcttcttctcctttgtgaagctgcattgggcctt
tatttttcccgggacacttactcagaaaaaatctatatcgacgaacctgttggaacgccc
ctgctctacgttcatgccttacaggatgcccaaggggaggtgccccacttccgcctgggc
cagcacctctatagcagctaccgatcacagccacacaagaatgactggttccagatcaat
gaagacacaggccttctctacctcaaccagagtctggaccaaagggccttcgagaaactg
agcgcccgaagtggaggatttcccttgctcaccatctaccttcaggttttcctctcaccc
agaccattccgggaaagtgattgtcactggccaagctgtgccaaagtgatgctgtccatc
atcaacaccaccatgccagcctgcagctccctgaagcccagggagttctgcttcctggag
acgggcctctcattccgcatcagggagaataaaccaccgggcactttccaccagttccgt
ctccttcctgtgcagcgtctgtgcccaaatatcagcatttcctaccagctgcttagagat
gaagaccttcccttccattctgataaggacaccatggaggtcagcatgaggcactctctg
gaccgggaacaaaaggaaaagtatgagttggttgccaagtgcacagttcgggaaggtttg
cgagaagataatgtgatggtaccctttcctgtgactgtatatgatgaggacgattcacct
cctaatttccccaccggcatcaacacagccaatgcagttgtggaatacaaacggaaagag
ggtacagtattggcagtgctacaggtctttgatgcagatgtggtaccatcttctggggac
atcccaagaaagtacatacacaccatgctaaccagtgaccctcgggtcattaagttcttc
cgggtggagcacttaccaaatgagacctcttacaactctaatggaagccgtgtgcgggca
atgatgcacgactacaaactggtactcaaccaaagtgtccctatcacagagaaccattct
ttccagttgggagtcctggtgaatgacactgacttccagggtcctggaggggtactacag
ctctattttaatgtgaccatcctgcctgtcagcatacagttcccaaacatctcctactcc
ttctcagtaaatcgaaacgctcaccgatatgcacagattggaaaagtttgcattgaaaac
tgcaaggagttccacggagtgaatattacctacaaactacaatctctcagtgttaactgc
agtgctctaagcatcatcacctccccagaaagcaccacagggaatctgtttgtgaatgat
acctccatgcttcaaaggccagaatgcacaggaatgaaatacgatgtgtttgcaacagac
aaacagagtaggaaacagtccaaaacaacgcttactatctctgtagaaggaaatttttcc
cctgaggaggagggctgtccaatttcatgtgctgtgaacaagagacgtttagagtgtgaa
gagtgtggtggcttgggcactctgatgggcacatgccagtggagacaaggagatggcaaa
ggaatttccaagaactattcgacctgcacgccaagcctcaagacttgtcctgatggcagc
tgtgatgccgtggaaagtcgagatcttcatatctgccctcaagattgcatacggggagac
gttattggtggtcacgagaaaggggagtggaggggaatcaaggctggatatggagtctgc
aactgcttcccagaagaaaagaagtgtttctgtgagcccgatgatgacaaagaaccgctt
tgtgatgaagtctgcaggatggtcattgctgttgccatcctgttctctttcatcttctct
gtgctgctctcttcctacttcatccgccgctaccataagaactcccacaagccacccatt
gcctctgcagagatgaccttcaggagacctgctcaggcctaccccatcagctattcttcc
tccaatgttcgccggccatccctggactccatggagaaccaggtctcagtggatgccttc
aaaatccctgaggatccaaagtgggaatttcctcggaagaatttggttcttggaaaaacc
ctaggagaaggagagtttggaaaggttgtcaaggcaacagctttccgactcaaagggaaa
accggctacaccactgtggcagtgaaaatgctaaaagaaaatgcctctccgagtgagctc
aaagacttgctgtcagagtttaacctgttaaaacaggtcaaccaccctcatgtcattaaa
ctctatggagcctgcagtcaggatggacctctctacctgattgtggagtatgccaagtat
ggttctttgcggagtttcctccgggaaagtcggaaggtgggacccagctacatgggtggt
aatggcaatcggaattctacctacttggacaatccagatgagagggcactgaccatggga
gatcttatttccttcgcctggcagatttcccgaggaatgcattatcttgcagaaatgaag
ctggtccaccgtgatttagcagctagaaatgtcttggtggctgaaggacgcaaaatgaag
atttctgattttggcctttcccgagatgtttatgaagaggactcttatgtcaaaaggagc
aagggccggattcctgtaaagtggatggcgattgagtctctttttgatcatatctacacg
acccaaagtgatgtgtggtcatttggcgtgcttctctgggagattgtgaccctaggagga
aacccctatcctggtattcctcctgaacgtctcttcaaccttctaaaaacaggctatcga
atggagaggcctgaaaactgcagtgaagaaatgtacaatctgatgttgcactgctggaag
caggaaccagataagaggccaatatttggggaaatcagcaaagacctagagaagatgatg
gtgaagagtagggactacttggatcttgcagcttccaccccatctgactccttactttat
gacgatggcctttcagaagaggagacacccctcgtggactgtaataatgctcccctccct
cgaaccctcccttccacatggattgaaaacaaactctatggcatgtcatacccgaactgg
cctgaggagagtcctgtcccactcacaagattcgatggcactaactctgtgttttcaaga
tatgcaaatgatagtgtatatgctaactggatggtttcaccctcagcggcaaaattaatg
gacaagtttaatagttaa

DBGET integrated database retrieval system