KEGG   Phascolarctos cinereus (koala): 110207195
Entry
110207195         CDS       T05867                                 

Gene name
TMEM25
Definition
(RefSeq) transmembrane protein 25 isoform X1
  KO
K22652  transmembrane protein 25
Organism
pcw  Phascolarctos cinereus (koala)
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pcw04515]
    110207195 (TMEM25)
Cell adhesion molecules [BR:pcw04515]
 Immunoglobulin superfamily
  TMEM25
   110207195 (TMEM25)
SSDB
Motif
Pfam: C2-set_2 Ig_3 I-set
Other DBs
NCBI-GeneID: 110207195
NCBI-ProteinID: XP_020840445
LinkDB
Position
Unknown
AA seq 395 aa
MADRVLIGPVCPCSEPLHHTAVFIRPEQLLSPVLERSLDQGLTGEGSRALLSSGQGELAP
QIDGQTWAERALRENERHAFTCQVEGGHDPPRLAWYLDGQLQEANTSRLLSVGGEAFTGS
TSTFTITAQRAQHELNCSLQDPDTRRVANASVILNVQFKPEIAQVGAKYQEAQGPGLLVV
LFALVRANPPANVTWIDRDGPVTVNTSDFLVLDAQSYPWLTNHTVQLQLHSQAQNLSVVA
ANGVGVTSSSLPAPGLLATQVEVPMLGIVVAGALGLGTLVGFSTLVACLVCRKDKKTTGT
SRRPSLLSSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPNARAKPTDGQIPQNTKRPDIL
DPENGVLFTSQGFVHLPMLGYIYRASSMSSDEIWL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcagatcgggtattgattggccctgtctgcccatgctccgagcccctgcatcatact
gcagtattcatcagacctgagcagttgctgtccccagtcctggagaggagcctggaccag
ggtttgacaggggagggatcccgggccttgctgagctcaggccagggggagctggcgcct
cagatcgatgggcagacgtgggcagagcgggcactgagggagaatgaacgccatgccttc
acctgccaagtggaaggtgggcatgaccctccgaggctggcctggtacctggatggacaa
ttgcaggaggccaacacgtcgaggctgttgagtgtgggtggggaggccttcacaggcagc
actagcacttttacgatcaccgctcagagggctcaacatgagctgaactgctccttgcag
gatccagacaccaggagggtggccaatgcctcggtcatccttaatgtgcagttcaaacca
gagattgcccaggttggagccaagtaccaagaagcccagggcccagggctcttggttgtc
ctgtttgccctggtgcgggccaacccacctgccaatgtcacatggattgaccgggatgga
cctgtgactgtcaacacttctgatttcctggtgctggatgctcagagctacccgtggctc
accaaccatactgtgcaactacagctccacagccaggcccagaacctctctgtggtggcc
gccaatggcgtgggtgtcactagttcttccctcccagccccagggctcctggccacccag
gtggaagtgccgatgctgggtattgttgtggctggagcccttggtctgggcactctggtg
ggcttcagcactctggtggcctgcctggtctgcaggaaggacaaaaagactacaggcacc
tctcggcgcccatctctcctctccagtgactccaacaatctgaaactcaacaatgtgcga
ctgccccgggaaaacatgtccctcccttccaacctgcaactcaatgatctcactccgaac
gccagagccaaaccaactgatggacagataccacagaacaccaagaggcctgacatcctg
gaccctgagaatggtgtccttttcacgagccaaggttttgtacatcttccgatgctgggc
tacatctatcgggcatccagtatgagcagtgatgagatttggctgtga

DBGET integrated database retrieval system