KEGG   Phascolarctos cinereus (koala): 110207627
Entry
110207627         CDS       T05867                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04915  Estrogen signaling pathway
pcw05200  Pathways in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110207627 (TGFA)
   04012 ErbB signaling pathway
    110207627 (TGFA)
   04014 Ras signaling pathway
    110207627 (TGFA)
   04151 PI3K-Akt signaling pathway
    110207627 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110207627 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110207627 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110207627 (TGFA)
   05212 Pancreatic cancer
    110207627 (TGFA)
   05225 Hepatocellular carcinoma
    110207627 (TGFA)
   05214 Glioma
    110207627 (TGFA)
   05211 Renal cell carcinoma
    110207627 (TGFA)
   05215 Prostate cancer
    110207627 (TGFA)
   05223 Non-small cell lung cancer
    110207627 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110207627 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 UPF0560 TMEM154
Other DBs
NCBI-GeneID: 110207627
NCBI-ProteinID: XP_020840998
LinkDB
Position
Unknown
AA seq 160 aa
MVTPAGELALIGLGILLAVCQALENTTSALSAGPPMAAAVVSHFNDCPDSHSQFCFHGTC
RFLVEEEKPACKCHSGYVGARCEHADLLAVVAANQKKQTITALVVVSIVALVVLIGICVL
IHCCRIRRPCEWCRGFVCQHEKPSDLLKGGTACCRSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggttactccggcgggggagcttgcactgatcgggctaggtattttattagccgtgtgc
caggctttggagaatacaacatctgccttgagtgcaggtcccccaatggcagccgcagtg
gtttcacattttaatgactgtccagattcccacagtcagttctgctttcatggaacctgt
aggtttttggtggaagaggagaagccagcgtgtaaatgccattctggctatgtcggggca
cgatgtgaacatgcagaccttcttgccgtggtggcagccaatcagaagaaacagaccatc
actgccctggtggtggtttccatagtagccttggttgtcctcattgggatctgtgtacta
atacactgctgtcggataaggaggccttgtgagtggtgccggggcttcgtctgtcagcat
gagaagcccagtgacctcttgaagggaggaacagcctgttgtcgctcggagacagtggtc
tga

DBGET integrated database retrieval system