KEGG   Phascolarctos cinereus (koala): 110207921Help
Entry
110207921         CDS       T05867                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00020  Citrate cycle (TCA cycle)
pcw00190  Oxidative phosphorylation
pcw01100  Metabolic pathways
pcw01200  Carbon metabolism
pcw04714  Thermogenesis
pcw04932  Non-alcoholic fatty liver disease (NAFLD)
pcw05010  Alzheimer disease
pcw05012  Parkinson disease
pcw05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110207921 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110207921 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    110207921 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110207921 (SDHA)
   05012 Parkinson disease
    110207921 (SDHA)
   05016 Huntington disease
    110207921 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    110207921 (SDHA)
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110207921 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 110207921
NCBI-ProteinID: XP_020841335
LinkDB All DBs
Position
Unknown
AA seq 665 aa AA seqDB search
MSGVGVAVRLLLGRRLALTRAQWPATFQSSIRSFHFTISGGKRSSAKVSSSISAEYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEEGKIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCI
EDGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGP
EKDHVYLQLHHLPPEQLSTRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLKHVNGTDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAETCKPGD
KVPQIKSNAGEESVANLDKLRFASGNIRTSELRLNMQKSMQSHAAVFRVGSILQEGCQKL
SQLYGDLKHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKV
RIDEYDYSKPIEGQQKKPFEEHWRKHTLSYVDIETGKVSLEYRPVIDKTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggttggcgtagctgtgcggctgctgctcggccggcggctggctctgacgcga
gcgcagtggccagcaactttccagtccagcattcgaagttttcactttaccatcagtgga
ggaaaaaggtcatcagctaaggtttcaagttcaatttccgcagagtatcctgtagtagac
catgaatttgatgccgtggtagtaggcgctggaggagcaggtttacgagctgcttttgga
ctttctgaagctgggttcaatacagcatgtgttacaaagcttttccccaccaggtcacat
actgttgcagcacaaggaggaatcaatgctgctttggggaatatggaagaagacaactgg
agatggcatttctatgacactgtgaaaggttctgattggttgggtgatcaggatgcaatt
cattacatgacagagcaagcacctgcttcagtagttgagttggaaaattatggcatgcca
tttagtagaacagaagaaggaaagatttatcaacgagcttttggtggacagagcctaaag
tttgggaaaggaggacaggctcatcgatgctgttgtgtggcagacaggacaggccattcc
ttgttgcacactctgtatggaaggtctctgaggtatgataccagttattttgtggagtat
ttcgccttggatctcttgatggaagatggggagtgccgaggagtgattgcgttgtgcata
gaagatgggtccatacatcgtataagagcaaagaacacagttattgcaactgggggttat
gggcgtacctatttcagctgtacttctgctcatacaagcacaggagatggcacagctatg
gttacacgagcaggccttccttgtcaagacttagagtttgtacagttccatcccacaggc
atatatggtgctggctgtctcatcacagaaggatgtcgtggtgaaggaggcattcttatt
aatagtcaaggtgaaagatttatggaaagatatgcccccgttgcaaaggatctggcttcc
agggatgttgtgtctcgttctatgaccattgaaatccgtgaaggaagaggctgtggtcct
gaaaaagaccacgtctatctacagttacaccacctaccacctgagcagctatcaactcgc
ttgcctggaatatcagaaacagcaatgatatttgctggtgtggatgtcaccaaagaacca
attcctgtactccccactgtgcattataatatgggaggcattcctacaaactataagggg
caggttcttaagcatgtgaatggtacagatcaagttgtacctggtctttatgcttgtggt
gaagcagcctgtgcatcagtacatggtgctaatcgactgggagcaaactctcttctggat
ttggttgtctttggtcgtgcttgtgccctgagtattgcagaaacatgcaaacctggtgat
aaagtccctcaaattaaatcaaatgctggggaagaatctgttgcaaatcttgacaaatta
agatttgcttctggaaacataagaacatcagagctaaggcttaacatgcaaaagtccatg
cagagtcacgcagctgttttccgtgtgggaagtatattacaggaaggctgccagaaatta
agtcagctttatggtgacttaaagcatctgaagacatttgacagaggaatagtgtggaat
actgatttggtggagaccttggaattgcagaatctaatgttgtgtgctctgcaaactatt
tatggtgctgaggcccgtaaagagtcccgtggagctcatgccagagaagactacaaggta
aggattgatgagtatgattattctaagccaattgagggacaacaaaagaaaccatttgaa
gaacattggagaaagcacacactttcttatgtggatatcgagactggaaaggtttctttg
gaatataggcctgtaattgacaaaactttaaatgaagctgactgtgccacagttccacct
gctattcgctcttattga

DBGET integrated database retrieval system