KEGG   Phascolarctos cinereus (koala): 110209152
Entry
110209152         CDS       T05867                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6 isoform X1
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04110  Cell cycle
pcw04115  p53 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04218  Cellular senescence
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05206  MicroRNAs in cancer
pcw05212  Pancreatic cancer
pcw05214  Glioma
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110209152 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110209152 (CDK6)
   04115 p53 signaling pathway
    110209152 (CDK6)
   04218 Cellular senescence
    110209152 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110209152 (CDK6)
   05206 MicroRNAs in cancer
    110209152 (CDK6)
   05203 Viral carcinogenesis
    110209152 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110209152 (CDK6)
   05225 Hepatocellular carcinoma
    110209152 (CDK6)
   05214 Glioma
    110209152 (CDK6)
   05220 Chronic myeloid leukemia
    110209152 (CDK6)
   05218 Melanoma
    110209152 (CDK6)
   05224 Breast cancer
    110209152 (CDK6)
   05222 Small cell lung cancer
    110209152 (CDK6)
   05223 Non-small cell lung cancer
    110209152 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110209152 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110209152 (CDK6)
   05164 Influenza A
    110209152 (CDK6)
   05162 Measles
    110209152 (CDK6)
   05163 Human cytomegalovirus infection
    110209152 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110209152 (CDK6)
   05169 Epstein-Barr virus infection
    110209152 (CDK6)
   05165 Human papillomavirus infection
    110209152 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110209152 (CDK6)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110209152 (CDK6)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110209152 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 Kinase-like FTA2 Seadorna_VP7
Other DBs
NCBI-GeneID: 110209152
NCBI-ProteinID: XP_020843069
UniProt: A0A6P5KDL9
LinkDB
Position
Unknown
AA seq 326 aa
MDKDGLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPDPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSNGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPNDVALPRQAFNAKSPQPIEKFVTDIDELGKDLLMKCLTFNPAKRISACGALSHPYF
HDVEKPHENVDPRTSPSQSSSEGNSA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggacaaggacggcctgagccgggctgaccagcagtacgagtgcgtggccgagatcggc
gagggcgcctacgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctcaagcgcgtgcgggtgcagaccggggaggagggcatgccgctctccaccatccgc
gaggtggcggtgttgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacggtgtcacggacagacagagaaaccaagctcacgctagtgttcgaacac
gttgatcaagacttgaccacctatttggataaagttccagacccaggagtacccacagaa
acaatcaaggacatgatgtttcagctactccgaggtctggattttcttcattcgcaccga
gtagtgcaccgggatctgaaaccacagaatatccttgtcaccagcaatggacagattaaa
ctggccgattttggccttgcacggatctacagttttcaaatggctcttacctcagtggtt
gtcactttatggtacagagcgcctgaagtcttgcttcagtccagttatgccacgccagtg
gacctatggagtgttggctgcatatttgcagaaatgtttcgtcgaaagcctctttttcgt
ggaagttcagatgttgatcaactaggaaaaatcttggatgtcattggacttccaggtgaa
gaagactggccaaatgatgtggccctccccaggcaggcttttaatgcaaaatctccccaa
ccaatcgaaaagtttgtaacagatattgatgagctaggcaaagacttacttatgaagtgc
ttgacattcaacccagcaaagagaatttcggcttgtggtgcattgtctcacccgtatttc
catgatgtagagaagcctcatgagaatgtggaccctcggacatcccccagccaaagcagc
agtgaggggaacagtgcttga

KEGG   Phascolarctos cinereus (koala): 110210989
Entry
110210989         CDS       T05867                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw04110  Cell cycle
pcw04115  p53 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04218  Cellular senescence
pcw04530  Tight junction
pcw04660  T cell receptor signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05212  Pancreatic cancer
pcw05214  Glioma
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110210989 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110210989 (CDK4)
   04115 p53 signaling pathway
    110210989 (CDK4)
   04218 Cellular senescence
    110210989 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110210989 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110210989 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110210989 (CDK4)
   05203 Viral carcinogenesis
    110210989 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110210989 (CDK4)
   05225 Hepatocellular carcinoma
    110210989 (CDK4)
   05214 Glioma
    110210989 (CDK4)
   05220 Chronic myeloid leukemia
    110210989 (CDK4)
   05218 Melanoma
    110210989 (CDK4)
   05219 Bladder cancer
    110210989 (CDK4)
   05224 Breast cancer
    110210989 (CDK4)
   05222 Small cell lung cancer
    110210989 (CDK4)
   05223 Non-small cell lung cancer
    110210989 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110210989 (CDK4)
   04934 Cushing syndrome
    110210989 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110210989 (CDK4)
   05160 Hepatitis C
    110210989 (CDK4)
   05164 Influenza A
    110210989 (CDK4)
   05162 Measles
    110210989 (CDK4)
   05163 Human cytomegalovirus infection
    110210989 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110210989 (CDK4)
   05169 Epstein-Barr virus infection
    110210989 (CDK4)
   05165 Human papillomavirus infection
    110210989 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110210989 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110210989 (CDK4)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110210989 (CDK4)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110210989 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 110210989
NCBI-ProteinID: XP_020845799
UniProt: A0A6P5KJG1
LinkDB
Position
Unknown
AA seq 304 aa
MDIPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVKVPTGGGSGGGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPLETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSCQMALTPVVVTLWY
RAPEVLLQSAYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLSKIFDLIGLPAEDDWPT
DVSLPRGAFTPCSPQPLQSVVPELEGPGAQLLLEMLTFSPHKRISAFRALQHTYLQTAGE
GNPE
NT seq 915 nt   +upstreamnt  +downstreamnt
atggacattcctcggtatgaaccagtggccgagattggtgttggtgcctatgggaccgtg
tacaaggcccgtgacccccacagcggccacttcgtggcactcaagagcgtgaaagtcccg
accggaggaggaagtggagggggcctgcctgtcagcactgtccgggaggtggccctcctt
cggcggctggaggcctttgagcatcccaacgtggtccggctgatggatgtctgtgccact
gcccgaactgaccgagagaccaaggtgaccctggtgtttgaacacgtggaccaagacctg
aggacgtatctggacaaggcccctccaccagggctgcccttggagaccattaaggaccta
atgagacagttcttaagaggcctagactttcttcatgccaactgcattgtccaccgtgac
ctgaagccagaaaacatccttgtgactagtagtggaacagtcaagctggctgactttggc
ttagcccggatctacagctgccagatggcactcacacctgtggtagtcactctctggtac
cgggctcctgaggttctcctgcagtcagcatatgcaacacctgtggacatgtggagtgtt
ggctgcatcttcgcagagatgttccgtaggaagcctctcttctgtggaaactctgaagct
gaccagttaagcaaaatctttgacctgattgggctcccagcagaagatgattggcctact
gatgtttctctgccccgtggagcctttactccttgtagtccccagcctttacagtctgtt
gtgcctgagctggagggacctggagcacaactgctactggaaatgctgacctttagcccc
cacaaacgaatctctgctttccgagctctgcaacacacttatctacagacagctggggaa
gggaacccagaatga

DBGET integrated database retrieval system