KEGG   Phascolarctos cinereus (koala): 110209480Help
Entry
110209480         CDS       T05867                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00480  Glutathione metabolism
pcw00980  Metabolism of xenobiotics by cytochrome P450
pcw00982  Drug metabolism - cytochrome P450
pcw00983  Drug metabolism - other enzymes
pcw01100  Metabolic pathways
pcw01524  Platinum drug resistance
pcw05200  Pathways in cancer
pcw05204  Chemical carcinogenesis
pcw05225  Hepatocellular carcinoma
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110209480
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110209480
   00982 Drug metabolism - cytochrome P450
    110209480
   00983 Drug metabolism - other enzymes
    110209480
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110209480
   05204 Chemical carcinogenesis
    110209480
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110209480
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110209480
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110209480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcw02000]
    110209480
Enzymes [BR:pcw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110209480
Transporters [BR:pcw02000]
 Other Transporters
  Pores ion channels [TC:1]
   110209480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C Glutaredoxin GST_C_2 FKBP_N_2 DUF5118 Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 110209480
NCBI-ProteinID: XP_020843634
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MSGESLRSLGKGSAQPGPVPLGVIRVYSMRFCPFAERTRLILKAKGIKHEVININLKNKP
EWFFKKHPLGLVPVLETSKGQLIHESSITCEYLDEAYPEKRLFPEDPYEKALQKMILELF
SKIPSLSKDVLIAVRNGEDCTTRKAELCKEFSKLEEVLTRQKTMFLGGNSISMIDYLIWP
WFERLESFEIADCMDHTPALKLWVTNMKKDPTVEALLTDVKTYKGFFDLYFQNDPNAFDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgagtcgctccgcagcctgggaaaaggcagcgctcaacccggcccagtgccg
ctgggagtcatacgggtgtacagcatgagattctgccccttcgcggagagaacccggctc
atcctgaaggccaaaggaatcaagcatgaggtcatcaatattaacttgaaaaacaagcct
gaatggttctttaagaaacacccccttggtctagtaccagttctggagaccagtaagggt
cagctgatacatgaatcttccatcacttgtgaatacctagatgaagcttatccagaaaag
aggctgtttccagaagatccatatgagaaagctttacaaaagatgattttggagttgttt
tctaagataccatctttgtccaaggatgttcttatagcagtacgaaatggggaagactgc
accactcgtaaagcagaactctgtaaggaattcagcaaactggaggaggttcttacccgg
cagaagacaatgttccttggtgggaactctatatctatgattgattacctaatctggccc
tggtttgaacggttggaatcatttgagatagctgactgcatggaccacacgcctgctctg
aagttgtgggtcaccaacatgaagaaggaccccacagttgaagctctcctcactgacgtg
aagacatataaaggcttctttgatctctattttcagaatgatcccaatgcctttgactac
gggctgtga

DBGET integrated database retrieval system