KEGG   Phascolarctos cinereus (koala): 110209937Help
Entry
110209937         CDS       T05867                                 

Gene name
LPAR3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04015  Rap1 signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04080  Neuroactive ligand-receptor interaction
pcw04151  PI3K-Akt signaling pathway
pcw05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110209937 (LPAR3)
   04072 Phospholipase D signaling pathway
    110209937 (LPAR3)
   04151 PI3K-Akt signaling pathway
    110209937 (LPAR3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110209937 (LPAR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110209937 (LPAR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pcw04030]
    110209937 (LPAR3)
G protein-coupled receptors [BR:pcw04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    110209937 (LPAR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 110209937
NCBI-ProteinID: XP_020844378
LinkDB All DBs
Position
Unknown
AA seq 355 aa AA seqDB search
MNECHYDKRMDFFYNMSNTATADEWTGTNLVIVLCFGTFFCLFIFISNSLVIAAVVKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDTSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLIWAIAIFMGAVPTLGWNCVCAISTCSSLA
PIYSRSYLIFWTVSNLVAFFIMVVVYLRIYMYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCTRCGVQHVKRWFLLLALLNSVMNPIIYSYKDEEM
YSTMKRMICCCSRGETPERRSSRIPSTVLSRSTDTSSQYMEDSINQGTICNKGHS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagtgccactatgataaacgcatggactttttctataacatgagcaacaccgct
actgcagatgaatggacggggaccaatcttgtgattgttctctgctttgggaccttcttc
tgcctgtttatctttatttctaattctctggtcatcgcggctgtggtcaagaacagaaag
tttcatttccccttctactacctgctggctaacctcgctgccgcagacttctttgctggc
atcgcctacgtgttcctcatgttcaacactggtcctgtctccaaaacattgaccgtcaac
cgttggtttctgcgccaggggctcctggacaccagcttgacggcctctctgacaaatctg
ctggtcattgcagtggagaggcacatgtccatcatgagaatgagagtccatagtaatctg
accaagaagagggtgacgctgctgatcctgctcatttgggctattgcaatattcatgggg
gctgtccccacacttggctggaactgcgtatgcgccatctctacttgctcctccttagct
cccatttatagcaggagctacctcattttctggacagtgtccaaccttgtggccttcttc
atcatggtggtggtgtacctgcgtatctacatgtatgtgaagaggaaaaccaatgtcttg
tctccacacacgagtggctccattagccgccgccggacaccgatgaagctaatgaagaca
gttatgactgtcttaggagcttttgttgtgtgctggactcctgggttagtagtcctgctc
ctggacggtctaaattgtactcgctgtggtgtgcagcacgtcaaaaggtggttcctgctg
ctggccctactcaactcggtcatgaacccgatcatttattcctacaaagatgaagagatg
tacagcaccatgaagcgcatgatctgctgttgttctcgtggtgaaaccccagagaggagg
tcttccaggattccatccacagtcttaagcaggagcactgacacctccagtcagtatatg
gaagacagcattaaccaagggacgatatgtaacaaagggcactcctga

DBGET integrated database retrieval system