KEGG   Phascolarctos cinereus (koala): 110210908
Entry
110210908         CDS       T05867                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04068  FoxO signaling pathway
pcw04110  Cell cycle
pcw04114  Oocyte meiosis
pcw04115  p53 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04218  Cellular senescence
pcw04914  Progesterone-mediated oocyte maturation
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05215  Prostate cancer
pcw05222  Small cell lung cancer
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110210908 (CDK2)
   04151 PI3K-Akt signaling pathway
    110210908 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110210908 (CDK2)
   04114 Oocyte meiosis
    110210908 (CDK2)
   04115 p53 signaling pathway
    110210908 (CDK2)
   04218 Cellular senescence
    110210908 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    110210908 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110210908 (CDK2)
   05203 Viral carcinogenesis
    110210908 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    110210908 (CDK2)
   05215 Prostate cancer
    110210908 (CDK2)
   05222 Small cell lung cancer
    110210908 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110210908 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110210908 (CDK2)
   05161 Hepatitis B
    110210908 (CDK2)
   05160 Hepatitis C
    110210908 (CDK2)
   05162 Measles
    110210908 (CDK2)
   05169 Epstein-Barr virus infection
    110210908 (CDK2)
   05165 Human papillomavirus infection
    110210908 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110210908 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcw03032]
    110210908 (CDK2)
   03036 Chromosome and associated proteins [BR:pcw03036]
    110210908 (CDK2)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     110210908 (CDK2)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: CMGC group
  CDK family
   110210908 (CDK2)
DNA replication proteins [BR:pcw03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110210908 (CDK2)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110210908 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 110210908
NCBI-ProteinID: XP_020845652
UniProt: A0A6P5KLZ4
LinkDB
Position
Unknown
AA seq 350 aa
MDNFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMDLLSTYCVPSTVLGAVGDNRRSGRHSPCPLYSYLEVAASQGGGM
TSVPTPHPITRRALFPGDSEIDQLFRIFRTLGTPDEVAWPGVTSMPDYKPSFPKWARQDF
SKVVPPLDEDGQSLLSQMLHYDPNKRVSAKAALTHPFFLDVTKPVPHLRL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggataatttccaaaaggtggagaagatcggagagggcacttacggggtggtgtataaa
gcgaagaacaaggtgactggagaagtggtggcgctcaagaaaatccgtctggacactgag
acagagggcgtccccagtactgccattcgagagatctctctactcaaggaacttaatcac
cccaacattgtcaagctgctggatgttatccatacagaaaacaaactctacctggttttc
gaattcctgcatcaggatttgaagaagttcatggatgcatctgcactcacaggcatccct
ttacctctcattaagagctacctgtttcagctcctccagggtctagccttctgccactct
cacagagtcctgcatcgagacctcaagccacagaacctcctcatcaatgctgaaggctcc
atcaagctggctgactttggacttgccagggcctttggagtacctgttcgtacctatact
catgaggtggtaaccctgtggtatcgagcaccagaaatcctcttgggttgtaaatactac
tcgacagctgtagatatatggagcctgggttgtatctttgctgagatggatttattaagc
acctactgtgtgcccagcactgtgctaggtgctgtgggggataacagaagaagtggaaga
cacagtccctgccctctgtactcctatctagaagtggctgcatcacaaggaggggggatg
acttcagtgcccaccccacaccccattacccgtagggctttattccctggagactcagaa
attgaccagctgttcaggatctttcggacactgggaacaccagatgaggtagcttggcca
ggagtgacctccatgcctgattataaacccagcttccctaaatgggcacgacaagatttc
agtaaggtggtccctccactagatgaagatggacagagcttgctgtcgcaaatgctgcac
tatgaccctaacaagcgtgtttcagccaaggcagctctaactcatcccttcttcctggat
gttactaagcctgtaccccacttgcgactctga

DBGET integrated database retrieval system