KEGG   Phascolarctos cinereus (koala): 110211229Help
Entry
110211229         CDS       T05867                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00010  Glycolysis / Gluconeogenesis
pcw00030  Pentose phosphate pathway
pcw00051  Fructose and mannose metabolism
pcw00052  Galactose metabolism
pcw01100  Metabolic pathways
pcw01200  Carbon metabolism
pcw01230  Biosynthesis of amino acids
pcw03018  RNA degradation
pcw04152  AMPK signaling pathway
pcw05230  Central carbon metabolism in cancer
Module
pcw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110211229 (PFKP)
   00030 Pentose phosphate pathway
    110211229 (PFKP)
   00051 Fructose and mannose metabolism
    110211229 (PFKP)
   00052 Galactose metabolism
    110211229 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    110211229 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    110211229 (PFKP)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    110211229 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcw01009]
    110211229 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcw03019]
    110211229 (PFKP)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     110211229 (PFKP)
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110211229 (PFKP)
Messenger RNA biogenesis [BR:pcw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     110211229 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK CBS
Motif
Other DBs
NCBI-GeneID: 110211229
NCBI-ProteinID: XP_020846040
LinkDB All DBs
Position
Unknown
AA seq 753 aa AA seqDB search
MNAAVRAVVRMGIYVGAKMYFVYEGYQGMVDGGNNIVEVTWECVSSILQVGGTVIGSARC
QAFRTREGRLQAAYNLIQKGITNLCVIGGDGSLTGANLFREEWNGLLEELAQTGKIEKEA
VKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPEYPPEEGWEKQLCVKLSENRARKKRLNIIIVAEGAIDI
HNKPISSEKVKDLVVSQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVDAVLALLEATP
NTPACVVSLSGNQSVRLPLMECVHMTQEVQKAMDNRQFDEAVKLRGRSFENNLNTYKMLS
QKKSDAELPKSNFNVAVMNVGAPAAGMNAAVRSAVRMGIIEGHKMLAVSNGFEGFSKGQI
KEISWGAVGGWTGQGGSILGTKRTLPAKYLEKIAEQMRSHNINALLVIGGFEAYLGLLEL
SAAREKYEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKLSASGTKRRVF
IIETMGGYCGYLASMGGLSAGADVAYIFEEQFDIRELQANVEHLTEKMKTSIQRGLVLRN
ENCNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAIQWIS
HKLRESYRKEEGKVFANTDDSVCLLGMRTRTLLFQPVAELKDQTDFVHRIPKEQWWLKLR
PLMKILAKYKISYDISDSGQLEHVPGCNIQTSS
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgttcgagctgtggttcggatgggaatctatgtgggagccaaaatgtat
tttgtgtatgagggttatcaaggtatggtagatggaggcaataacatcgttgaagtgacc
tgggaatgtgtttccagcattctccaagtgggaggaacagtcattggcagtgcacgttgc
caagcattccgtacccgggaaggccgcttacaagcagcttataatttgattcaaaaggga
atcactaacctgtgtgtgattggtggtgatggaagcttaacaggcgccaacttgttccgt
gaagaatggaatggactgctggaagaattagcccaaaccggtaaaattgaaaaagaggcc
gtgaagaaatatgcctatctcaacattgtggggatggtgggttctatagacaatgacttc
tgtgggacagatatgacgattggcaccgactctgctttgcacagaatcattgaagtcgtg
gatgccatcatgaccactgctcagagtcaccagaggacctttgttctggaggttatggga
agacactgtgggtatctagcccttgtaagtgccctggcttgtggtgcagattgggttttc
attcctgaatacccaccagaagaaggctgggagaagcaactatgcgttaaactatcagag
aaccgtgccaggaagaagaggctgaacatcatcattgttgcagaaggagcgattgatatc
cataataaaccaatttcttcagagaaggttaaggatcttgtagttagtcagctgggctat
gatactcgtgtgacaattcttggacatgtccaaagaggaggaactccttctgctttcgac
aggattctggctagtcgcatgggtgtggatgctgtattggccctcctcgaggctacacca
aataccccagcgtgtgttgtgtctctgtctggaaaccagtctgtacgtctacccctgatg
gagtgtgtgcatatgactcaggaagttcagaaggcaatggataatagacaatttgatgag
gctgtgaagcttcgaggaaggagctttgagaacaacctgaacacctataaaatgctttct
caaaaaaaatcggatgcagagcttccaaagagcaattttaatgtggctgttatgaatgtg
ggtgctcctgctgcagggatgaatgctgctgttcgttcagcagtgagaatgggcatcatc
gagggtcataagatgcttgctgtcagtaatggctttgaaggattttctaagggtcagata
aaagaaatcagctggggagctgttggaggttggactggccaaggaggatccattcttggc
acaaaacgtactcttcctgcaaagtatttggagaagattgctgaacagatgcgtagtcat
aatatcaacgctcttttggttattggtggatttgaggcctacctgggattgctggaactg
tcagctgcccgtgaaaaatatgaggaattctgtgttcctatggttatggttcctgcaact
gtatccaacaatgtgccaggttcagatttcagcattggtgcagatactgctctgaacact
atcactgacacctgtgatcgaatcaagctatcagccagtgggaccaagaggcgagtcttc
atcatcgagacaatgggtggctactgcggatatctggccagcatgggtggcctttctgct
ggggccgatgtagcgtatatttttgaagaacagtttgacatccgagaactacaggctaat
gtggaacatttgacagagaaaatgaagaccagcatacaacgaggcctggtactcagaaat
gagaactgtaatgaaaattacaccactgatttcatttatcagctctattctgaggaagga
aaaggagtattcgattgcagaaagaatgttttgggtcacatgcaacagggtggagcacct
tctccttttgacagaaactttggaacaaaaatttctgccaaagctattcagtggatttca
cataaactgagggaaagctatcgaaaagaagaaggaaaagtatttgccaacaccgatgat
tcagtttgtctgctaggaatgcgcacacggactcttcttttccaacctgtggctgaacta
aaggatcaaactgattttgtgcacagaattcccaaagaacaatggtggttgaaactacga
cctttgatgaaaattttggccaagtacaaaatcagctatgatatttctgattcaggtcag
ctagaacatgtacccggctgcaacatccaaacaagcagttaa

DBGET integrated database retrieval system