KEGG   Phascolarctos cinereus (koala): 110211245
Entry
110211245         CDS       T05867                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 isoform X1
  KO
K05719  integrin beta 1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04015  Rap1 signaling pathway
pcw04145  Phagosome
pcw04151  PI3K-Akt signaling pathway
pcw04360  Axon guidance
pcw04510  Focal adhesion
pcw04512  ECM-receptor interaction
pcw04514  Cell adhesion molecules
pcw04530  Tight junction
pcw04611  Platelet activation
pcw04670  Leukocyte transendothelial migration
pcw04810  Regulation of actin cytoskeleton
pcw05100  Bacterial invasion of epithelial cells
pcw05133  Pertussis
pcw05135  Yersinia infection
pcw05140  Leishmaniasis
pcw05145  Toxoplasmosis
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05222  Small cell lung cancer
pcw05410  Hypertrophic cardiomyopathy
pcw05412  Arrhythmogenic right ventricular cardiomyopathy
pcw05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110211245 (ITGB1)
   04151 PI3K-Akt signaling pathway
    110211245 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110211245 (ITGB1)
   04514 Cell adhesion molecules
    110211245 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110211245 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110211245 (ITGB1)
   04530 Tight junction
    110211245 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110211245 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110211245 (ITGB1)
   04670 Leukocyte transendothelial migration
    110211245 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    110211245 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110211245 (ITGB1)
   05205 Proteoglycans in cancer
    110211245 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110211245 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110211245 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110211245 (ITGB1)
   05414 Dilated cardiomyopathy
    110211245 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110211245 (ITGB1)
   05133 Pertussis
    110211245 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    110211245 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110211245 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110211245 (ITGB1)
   05140 Leishmaniasis
    110211245 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110211245 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110211245 (ITGB1)
   04515 Cell adhesion molecules [BR:pcw04515]
    110211245 (ITGB1)
   04090 CD molecules [BR:pcw04090]
    110211245 (ITGB1)
Membrane trafficking [BR:pcw04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    110211245 (ITGB1)
Exosome [BR:pcw04147]
 Exosomal proteins
  Proteins found in most exosomes
   110211245 (ITGB1)
Cell adhesion molecules [BR:pcw04515]
 Integrins
  Integrin beta subunits
   110211245 (ITGB1)
CD molecules [BR:pcw04090]
 Proteins
  110211245 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2 FSAP_sig_propep
Other DBs
NCBI-GeneID: 110211245
NCBI-ProteinID: XP_020846112
UniProt: A0A6P5KN50
LinkDB
Position
Unknown
AA seq 802 aa
MSLQLIFWVGLVSCSICQVWGQTGGNDCLKANAKSCGECIQAGPNCGWCTNSSFLQEGMP
TSARCDDLEALEKKGCRPEDIENPRGHKIIRKNKNVTNRSKGTAEKLQPEDITQIQPQQL
TLKLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMYEMKRITSD
FRIGFGSFVEKTVMPYISTTPAKLRNPCTGDQNCTSPFSYKNVLSLTDKGEVFNELVGKQ
HISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDG
QCHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQAVYKELKNLIPKSAVGT
LSANSSNVIQLIIDAYNSLSSEVILENGKLPEGVTINYKSYCKNGVNGTGENGRKCSNIS
IGDEVQFEISITSTKCPEEDTKTVKIKALGFTEEVEITLQFICECECQSEGLPNSPECHE
GNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCR
KRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSSC
MASNGQICNGRGVCVCGSCKCTDSKFQGATCEMCQTCLGVCVEHKECVQCRAFEKGEKKD
TCAKECSYFNITKVKSREDLPQPGQREALSHCKEKDVDDCWFYFTYSVNGNNEVVVHVVE
TPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQE
NPIYKSPINNFKNPNYGRKAGL
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgagtttacaactaattttctgggttggactggtcagttgctctatctgtcaagtatgg
ggccaaacaggtggaaatgactgcttaaaagcaaatgcaaaatcatgtggagaatgtatt
caagcaggaccaaattgtggatggtgcacaaattcctcatttttacaagaaggaatgcct
acttctgcccggtgtgatgatttagaagcattagaaaagaaaggctgccgtccagaggac
atagaaaatcctcgaggccacaaaattatccggaaaaataaaaatgtgacaaatcgcagt
aaaggtacagcagaaaaactccagcctgaagatattacccagatccaaccacagcagcta
actttgaagttacgctcgggagaaccacagacatttacattaaaattcaagagagctgaa
gactatcctattgacctctattatcttatggatctctcttactccatgaaagacgacttg
gagaatgtaaagagtcttggaacagatctaatgtacgaaatgaagagaatcacttcagat
ttccgaattggatttggttcctttgtggagaaaactgtgatgccatatattagtacaaca
ccggctaaactcaggaacccttgcacaggcgaccaaaactgcaccagtccatttagctac
aaaaatgtgctcagtcttacagataaaggggaagtgtttaatgagcttgtaggaaaacag
cacatttctggcaatttggattctccagaagggggatttgatgcaatcatgcaggttgca
gtttgtggatcattaattggctggagaaatgttacacgactattggttttttccactgat
gctgggtttcacttcgctggagatggtaaacttggtggaattgttttaccaaatgatgga
caatgtcacctagaaaataatgtgtacacaatgagccattattatgattatccttctatt
gctcaccttgtccaaaaactcagtgaaaataacattcagacaatttttgcagttacagaa
gaatttcaggctgtttacaaggaattgaagaatttgatccccaagtcagcagtaggaaca
ttgtctgcaaattctagtaacgtgattcagttgatcattgatgcatacaattccctgtct
tcagaagtcattttggaaaatggcaagttgccagagggagtaacaataaattacaaatct
tactgcaagaatggagtgaatgggacaggagaaaatggaagaaaatgttccaatatttcc
attggtgatgaggttcagttcgagattagcataacttccacaaaatgtcctgaggaggac
acgaaaaccgtcaaaattaaggctctgggtttcactgaagaagtagagattacactccag
tttatctgtgaatgtgagtgccagagcgaaggccttccaaatagtccagagtgccatgag
ggaaatggaacatttgagtgcggtgcctgccggtgcaacgagggacgtgttggtaggcat
tgtgaatgtagcacggatgaagtaaatagtgaagacatggatgcttattgcagaaaagaa
aatagttctgaaatttgcagcaataatggagaatgtgtctgtggacagtgtgtttgcagg
aagagggataatacaaatgaaatttattctggcaaattctgtgagtgcgacaattttaac
tgcgatagatccaatggattaatttgtggaggaaatggtgtttgcaagtgtcgagtgtgt
gagtgtaaccccaattacactggcagtgcttgtgattgctctttggatacatcttcatgt
atggcatcaaatgggcagatctgcaatggccgaggagtatgcgtatgtggttcctgtaaa
tgcaccgattctaaattccaaggggcaacttgtgagatgtgtcagacttgccttggtgtc
tgtgttgagcacaaagaatgtgttcagtgcagagcttttgaaaaaggagaaaaaaaagac
acatgtgcaaaagagtgttcttacttcaacattaccaaagtaaaaagtcgagaagactta
ccccagcctggccagcgggaggccctctcccactgtaaggagaaggatgttgatgactgc
tggttttattttacatattcagtcaatggaaataatgaagttgttgttcatgtagtggag
acaccagagtgtcccactggtccagatatcattcccattgtggctggagtggttgcagga
attgtgctgatcggccttgcattattgctgatttggaagttgctaatgataattcatgac
agaagagaatttgctaaatttgaaaaggagaaaatgaatgcaaaatgggacacgcaagaa
aatccgatttacaagagccctattaataatttcaagaatccaaactatggacgtaaagct
ggtctctaa

DBGET integrated database retrieval system