KEGG   Phascolarctos cinereus (koala): 110211412
Entry
110211412         CDS       T05867                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01524  Platinum drug resistance
pcw04014  Ras signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04115  p53 signaling pathway
pcw04137  Mitophagy - animal
pcw04140  Autophagy - animal
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04621  NOD-like receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05145  Toxoplasmosis
pcw05162  Measles
pcw05166  Human T-cell leukemia virus 1 infection
pcw05168  Herpes simplex virus 1 infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05212  Pancreatic cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110211412 (BCL2L1)
   04630 JAK-STAT signaling pathway
    110211412 (BCL2L1)
   04064 NF-kappa B signaling pathway
    110211412 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    110211412 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110211412 (BCL2L1)
   04137 Mitophagy - animal
    110211412 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    110211412 (BCL2L1)
   04215 Apoptosis - multiple species
    110211412 (BCL2L1)
   04115 p53 signaling pathway
    110211412 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110211412 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110211412 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    110211412 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110211412 (BCL2L1)
   05225 Hepatocellular carcinoma
    110211412 (BCL2L1)
   05220 Chronic myeloid leukemia
    110211412 (BCL2L1)
   05222 Small cell lung cancer
    110211412 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110211412 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    110211412 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    110211412 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110211412 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    110211412 (BCL2L1)
   05162 Measles
    110211412 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    110211412 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110211412 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110211412 (BCL2L1)
   01524 Platinum drug resistance
    110211412 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcw01009]
    110211412 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcw03036]
    110211412 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcw02000]
    110211412 (BCL2L1)
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110211412 (BCL2L1)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110211412 (BCL2L1)
Transporters [BR:pcw02000]
 Other transporters
  Pores ion channels [TC:1]
   110211412 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 PROCT
Other DBs
NCBI-GeneID: 110211412
NCBI-ProteinID: XP_020846347
UniProt: A0A6P5KNP0
LinkDB
Position
Unknown
AA seq 227 aa
MSHSNRELVVDFLSYKLSQKGYSWSQFEDENRTEAPEGTEIPSTVNGSPSWHPADSHAVS
GATGHSSSLDAHETIPVAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV
VNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVGRITSWMATYLDDHLDPWIQENG
GWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtctcacagcaaccgggagctggtggttgactttctttcttacaagctctcacagaaa
ggatacagttggagtcaatttgaagatgagaataggactgaggccccagaagggacagaa
atacctagtactgtgaatggcagcccctcttggcaccctgctgacagccatgcagtgagt
ggggccacaggacacagcagcagcctggatgcccatgagacaataccggtggctgctgtg
aagcaagctttgagggaggcaggagatgaatttgaactccggtaccgaagggccttcagt
gacctgacatcccagctccacatcactccagggacggcttatcagagctttgagcaggta
gtgaatgaactctttcgggatggggtgaactggggccgaattgtggcattcttctccttc
ggaggggcattgtgtgtggaaagcgtggataaggagatggaagtcttggtaggacgaatc
acctcctggatggccacttacttggatgaccacctagacccttggatccaagaaaatggc
ggttgggacaccttcgtggagctttatgggaacgatgcagctgcagagagccggaagggc
caggaacgcttcaaccgatggctgctgactggcatgacagtggctggtgtagtcctgctg
gggtccctgttcagccggaagtga

DBGET integrated database retrieval system