KEGG   Phascolarctos cinereus (koala): 110211795
Entry
110211795         CDS       T05867                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04210  Apoptosis
pcw04380  Osteoclast differentiation
pcw04620  Toll-like receptor signaling pathway
pcw04621  NOD-like receptor signaling pathway
pcw04622  RIG-I-like receptor signaling pathway
pcw04623  Cytosolic DNA-sensing pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04657  IL-17 signaling pathway
pcw04658  Th1 and Th2 cell differentiation
pcw04659  Th17 cell differentiation
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04668  TNF signaling pathway
pcw04722  Neurotrophin signaling pathway
pcw04920  Adipocytokine signaling pathway
pcw04926  Relaxin signaling pathway
pcw04931  Insulin resistance
pcw05132  Salmonella infection
pcw05134  Legionellosis
pcw05135  Yersinia infection
pcw05140  Leishmaniasis
pcw05142  Chagas disease
pcw05145  Toxoplasmosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05215  Prostate cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110211795 (NFKBIA)
   04668 TNF signaling pathway
    110211795 (NFKBIA)
   04024 cAMP signaling pathway
    110211795 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110211795 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110211795 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    110211795 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    110211795 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    110211795 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    110211795 (NFKBIA)
   04660 T cell receptor signaling pathway
    110211795 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    110211795 (NFKBIA)
   04659 Th17 cell differentiation
    110211795 (NFKBIA)
   04657 IL-17 signaling pathway
    110211795 (NFKBIA)
   04662 B cell receptor signaling pathway
    110211795 (NFKBIA)
   04062 Chemokine signaling pathway
    110211795 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110211795 (NFKBIA)
   04926 Relaxin signaling pathway
    110211795 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110211795 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110211795 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110211795 (NFKBIA)
   05203 Viral carcinogenesis
    110211795 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110211795 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    110211795 (NFKBIA)
   05215 Prostate cancer
    110211795 (NFKBIA)
   05222 Small cell lung cancer
    110211795 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110211795 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110211795 (NFKBIA)
   05135 Yersinia infection
    110211795 (NFKBIA)
   05134 Legionellosis
    110211795 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110211795 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    110211795 (NFKBIA)
   05161 Hepatitis B
    110211795 (NFKBIA)
   05160 Hepatitis C
    110211795 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    110211795 (NFKBIA)
   05164 Influenza A
    110211795 (NFKBIA)
   05162 Measles
    110211795 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    110211795 (NFKBIA)
   05163 Human cytomegalovirus infection
    110211795 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110211795 (NFKBIA)
   05169 Epstein-Barr virus infection
    110211795 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110211795 (NFKBIA)
   05140 Leishmaniasis
    110211795 (NFKBIA)
   05142 Chagas disease
    110211795 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110211795 (NFKBIA)
   04131 Membrane trafficking [BR:pcw04131]
    110211795 (NFKBIA)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    110211795 (NFKBIA)
Membrane trafficking [BR:pcw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    110211795 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 110211795
NCBI-ProteinID: XP_020847037
UniProt: A0A6P5KQE9
LinkDB
Position
Unknown
AA seq 321 aa
MFHAVMQPQEENPQEQGMENPRDGLKKERLLDDRHDSGLDSMKDEDYELMVKELKEIRIQ
PQEEQPGPPQEPWKQQVTEDGDTFLHLAIIHEEKTLTLEVIRQVAGDLAFLNAQNNLQQT
PLHLAVITKQPEIAETLLKAGCDPELRDFQGNTPLHLACEQGCLAGVGVLTQYCQTQDLL
SMLQSTNYNGHGCLHLASIHGYLAIVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPELV
SLLLRCGADVNKVTYQGYSPYQLTWGRENTTIQKQLGQLTMENLQMLPESEDEESNDTES
EFTEDELLYDDCVIGGQRLAL
NT seq 966 nt   +upstreamnt  +downstreamnt
atgtttcacgccgtgatgcagccgcaggaggagaacccccaggagcagggaatggagaat
ccccgggacggactcaaaaaggagaggcttttggatgatcgccatgatagcggcctggac
tccatgaaggacgaggattatgagctgatggtgaaggagctgaaggagatccggatccag
ccccaggaggagcaacccgggccgccccaagagccttggaaacagcaggtcaccgaggac
ggagacacatttctccacttggccattattcacgaagagaagaccttgactttggaagtc
atccgacaagtggcaggggacttggcttttctcaatgctcagaacaatctgcaacagact
cctcttcacttggcagtgatcaccaaacagccagagattgctgagacactcctgaaagct
ggctgtgacccagaactcagggactttcaagggaatacacctctgcacctcgcttgtgag
cagggctgcctggctggtgtaggagtacttacccaatattgccaaacccaggacctcctc
tcaatgctacaatccacaaactataatggtcacgggtgcctccatttggcttccatccat
ggctacttagcaatagtagaacatttggtgtccttgggagctgatgtcaatgctcaggag
ccctgtaatggccgaactgcccttcatcttgctgtagacctgcagaatcctgaacttgta
tcactccttctgcggtgtggggctgatgtgaacaaagttacctaccagggttactctcca
tatcaactcacttggggcagagagaacactactattcagaagcagttggggcagctgacc
atggaaaacctgcaaatgcttccagagagtgaagatgaagagagcaacgacacagagtca
gaattcacggaggatgaattgctttatgatgactgtgtgattggaggccaacgcttagca
ctatga

DBGET integrated database retrieval system