KEGG   Phascolarctos cinereus (koala): 110211817
Entry
110211817         CDS       T05867                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04060  Cytokine-cytokine receptor interaction
pcw04151  PI3K-Akt signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04640  Hematopoietic cell lineage
pcw04657  IL-17 signaling pathway
pcw04658  Th1 and Th2 cell differentiation
pcw04659  Th17 cell differentiation
pcw04660  T cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04672  Intestinal immune network for IgA production
pcw05140  Leishmaniasis
pcw05200  Pathways in cancer
pcw05310  Asthma
pcw05320  Autoimmune thyroid disease
pcw05321  Inflammatory bowel disease
pcw05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110211817 (IL4)
   04151 PI3K-Akt signaling pathway
    110211817 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110211817 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110211817 (IL4)
   04660 T cell receptor signaling pathway
    110211817 (IL4)
   04658 Th1 and Th2 cell differentiation
    110211817 (IL4)
   04659 Th17 cell differentiation
    110211817 (IL4)
   04657 IL-17 signaling pathway
    110211817 (IL4)
   04664 Fc epsilon RI signaling pathway
    110211817 (IL4)
   04672 Intestinal immune network for IgA production
    110211817 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110211817 (IL4)
  09163 Immune disease
   05310 Asthma
    110211817 (IL4)
   05320 Autoimmune thyroid disease
    110211817 (IL4)
   05321 Inflammatory bowel disease
    110211817 (IL4)
   05330 Allograft rejection
    110211817 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110211817 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcw04052]
    110211817 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110211817 (IL4)
Cytokines and growth factors [BR:pcw04052]
 Cytokines
  Interleukins
   110211817 (IL4)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Haparin
  Cytokines
   110211817 (IL4)
SSDB
Motif
Pfam: IL4 IL13 RPW8
Other DBs
NCBI-GeneID: 110211817
NCBI-ProteinID: XP_020847062
LinkDB
Position
Unknown
AA seq 156 aa
MRLTFQLIPTLFCLLTCTSDVVQGQRRTCQPSLREIVHMANSLTMKKFPCFEMEVPDIFE
DTENSSTPKLFPEESSCSQLVMTMNDFETLCRAVTVLQQVSNSCPFPKLSNMLRNLMHLV
NQTKCPVNETKITKLQDFLSKLKTINQKIFSKSAQF
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcgtctcacattccaactgataccaactttgttctgcctgttaacatgtaccagtgat
gttgtccagggacagagaaggacctgccaaccctctctcagagagatcgtccacatggca
aactctcttactatgaaaaagtttccctgctttgagatggaagtgccggacatctttgag
gatacagagaattccagtactccgaagctgtttcctgaggagtcatcatgctctcagctg
gtcatgacaatgaatgactttgaaacattatgcagagctgtcactgtgctccaacaggtc
tccaacagctgcccattccctaagctaagcaacatgcttaggaacctaatgcacttagtg
aatcagaccaaatgtcctgtgaatgaaaccaagattactaaattgcaagatttcctgagc
aaactaaaaaccatcaatcagaagatattttcaaaaagtgcacagttttag

DBGET integrated database retrieval system