KEGG   Phascolarctos cinereus (koala): 110211967
Entry
110211967         CDS       T05867                                 

Gene name
CKS1B
Definition
(RefSeq) cyclin-dependent kinases regulatory subunit 1 isoform X1
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110211967 (CKS1B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110211967 (CKS1B)
SSDB
Motif
Pfam: CKS DUF1633
Other DBs
NCBI-GeneID: 110211967
NCBI-ProteinID: XP_020847295
UniProt: A0A6P5KNV5
LinkDB
Position
Unknown
AA seq 82 aa
MSVLMLKECQVAIELRMRLARLWHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHY
MIHEPEPHILLFRRPLPKKPKK
NT seq 249 nt   +upstreamnt  +downstreamnt
atgtcggtactaatgctgaaggaatgccaggtggctatagaactgagaatgcgactggcc
cgcctgtggcacgtcatgttgcccaaggacatagccaaactggtccctaagacccacttg
atgtctgagtctgagtggaggaaccttggtgtccagcagagtcagggatgggtccattac
atgatccatgaaccagagcctcacatcttgctgttccggcggccactgcccaagaagcct
aagaaatga

KEGG   Phascolarctos cinereus (koala): 110223828
Entry
110223828         CDS       T05867                                 

Gene name
CKS2
Definition
(RefSeq) cyclin-dependent kinases regulatory subunit 2
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw05200  Pathways in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110223828 (CKS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110223828 (CKS2)
SSDB
Motif
Pfam: CKS Peptidase_M29
Other DBs
NCBI-GeneID: 110223828
NCBI-ProteinID: XP_020865178
UniProt: A0A6P5M5N7
LinkDB
Position
Unknown
AA seq 79 aa
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH
EPEPHILLFRRPLPKEQQK
NT seq 240 nt   +upstreamnt  +downstreamnt
atggcccacaagcagatctactactcggacaagtattttgatgagcactacgagtaccgg
catgttatgttacctagagaactttccaagcaagtaccaaaaacccatctgatgtctgaa
gaggagtggaggcgactgggtgtccagcagagtcttggatgggttcattatatgattcat
gagccagaaccacatattctgctctttagaagacctcttccaaaagaacaacaaaaatga

DBGET integrated database retrieval system