KEGG   Phascolarctos cinereus (koala): 110212621
Entry
110212621         CDS       T05867                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00562  Inositol phosphate metabolism
pcw01100  Metabolic pathways
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04020  Calcium signaling pathway
pcw04062  Chemokine signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04070  Phosphatidylinositol signaling system
pcw04072  Phospholipase D signaling pathway
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04380  Osteoclast differentiation
pcw04611  Platelet activation
pcw04625  C-type lectin receptor signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04670  Leukocyte transendothelial migration
pcw04722  Neurotrophin signaling pathway
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04919  Thyroid hormone signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05214  Glioma
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
Module
pcw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110212621 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110212621 (PLCG2)
   04014 Ras signaling pathway
    110212621 (PLCG2)
   04370 VEGF signaling pathway
    110212621 (PLCG2)
   04064 NF-kappa B signaling pathway
    110212621 (PLCG2)
   04066 HIF-1 signaling pathway
    110212621 (PLCG2)
   04020 Calcium signaling pathway
    110212621 (PLCG2)
   04070 Phosphatidylinositol signaling system
    110212621 (PLCG2)
   04072 Phospholipase D signaling pathway
    110212621 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110212621 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    110212621 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    110212621 (PLCG2)
   04662 B cell receptor signaling pathway
    110212621 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    110212621 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    110212621 (PLCG2)
   04670 Leukocyte transendothelial migration
    110212621 (PLCG2)
   04062 Chemokine signaling pathway
    110212621 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    110212621 (PLCG2)
   04919 Thyroid hormone signaling pathway
    110212621 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110212621 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110212621 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    110212621 (PLCG2)
   04380 Osteoclast differentiation
    110212621 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110212621 (PLCG2)
   05206 MicroRNAs in cancer
    110212621 (PLCG2)
   05205 Proteoglycans in cancer
    110212621 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110212621 (PLCG2)
   05214 Glioma
    110212621 (PLCG2)
   05223 Non-small cell lung cancer
    110212621 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110212621 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110212621 (PLCG2)
   05171 Coronavirus disease - COVID-19
    110212621 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110212621 (PLCG2)
   05169 Epstein-Barr virus infection
    110212621 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110212621 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110212621 (PLCG2)
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110212621 (PLCG2)
Membrane trafficking [BR:pcw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110212621 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110212621 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 110212621
NCBI-ProteinID: XP_020848293
UniProt: A0A6P5KU32
LinkDB
Position
Unknown
AA seq 1264 aa
MTAKISLDTLPEYEKSQIKRTLELGTVMTLFSLKKSNPERRTVQVITETRQVAWSKTADK
IEGFLDLMEIKEIRPGKNSKDFERGKASRQKEDCCFTIFYGTQFVLNTLSLAADSKEDAT
KWLCGLTILHQEAQSASTPAIIESWLRKQIYSVDQTRRNSISFRELKTILPLVNFKVSSA
KFLKDKFLEIGAYKDELSFEQFHLFYKKMMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQEIWAQDLSKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSKENS
IWDDKYDSVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTESYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIRDHAFVSSQFPVILSIEEHCCVEQQRHMARV
FKDVFGDLLLTKPTEASADQLPSPAQLKEKIVIKHKKLGPRGDVDINIEDKKEEKKQQGE
LYMWDTIDQKWYRHYCAIADEKLSFSDVIEQNAEEDSVKDVAQTDLHFGEKWFHKRMEKR
TSAEKLLQEYCAETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTLEGGAMKYY
LTDNLMFNSIYDLIQHYREAHLRCAEFELRLTDPVPNPNPHESKAWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGGDAYAITFRAKGKVKHCRINKDGHHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNTERDINSLYDVRMYVDPSEINPSTPQRTVKALYDYK
AKRGDELSFCRGALIHNVSKEPGGWWKGDYGGRIQQYFPSNYVEDISTVDFEELEKQIIE
DNPLGSLCRGILDLNTYNVVKVPHGKNQKPFVFILEPKKPNDPPIEFATDKVEELFEWYQ
SIREITWKNATVETNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVET
KADSIVRQKPIDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYM
QLNHALFALNGRTGYVLQPESMRNENYDPTPPESQRKILMTLTVKVLGARHLPKLGRSIA
CPFVEVEICGTEYDNNKFKTTVVNDNGLSPVWASTQEKVTFEIYDPNLAFLRFVVYEEDM
FSDPNFLAHATYPIKGIKSGFRAVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSCR
QLRRRQEELNNQLFLYDTHQNLRNASRDALVNEFNVNENQLQLYQEKCNRRLREKRVSNS
KFYS
NT seq 3795 nt   +upstreamnt  +downstreamnt
atgaccgccaagatcagcttagacacacttcctgaatacgagaagagtcagatcaagcgg
accctggaactaggaactgtcatgactctgtttagcctcaaaaagtctaaccctgagagg
aggacggtccaggtcatcacagagaccaggcaggtggcctggagcaagacggctgacaag
atcgaaggattcttggacttaatggagataaaggaaatccgcccagggaagaactcaaag
gactttgaacgtgggaaagccagtcgtcagaaagaagattgctgctttaccatattttat
ggcacccagtttgtcctcaacaccctgagtttagcagcggactccaaggaagatgctact
aaatggctttgtggcttgacaattttgcaccaagaagcccagagtgcctcaacgccagct
attattgagagctggctaagaaagcaaatttattctgtagatcaaactcggagaaatagt
atcagctttagagaactgaagaccattcttcccttagtaaacttcaaagttagcagtgcc
aagttcctgaaagacaaattcctggaaataggtgcctacaaggatgaactcagctttgaa
cagttccacttattctacaaaaagatgatgtttgagcaacagaaatcaattcttgatgag
ttcaaaaaagattcgtctgtgtttattctgggaaatacagaccggccagatgcatctgcc
gttcacctgcatgacttccagaggtttctgctgcatgaacagcaggaaatctgggcacag
gatctaagtaaagtaagagagcggatgacaaaatttatagatgacactatgagagaaaca
gctgagcccttcctatttgtcgatgagttcctcacttacctgttttcaaaagaaaacagc
atttgggatgataaatatgactctgttgacatgcaagacatgaataaccccttgtctcat
tactggatttcttcatctcataacacgtacctcactggggaccaacttcgaagtgaatct
tctactgaatcatacattcgatgtcttcgaatgggttgccgatgtatagagttggattgc
tgggatgggcctgatgggaagccaatcatctaccatggctggacgcggacgacgaagatc
aagtttgatgatgtggtgcaggccatcagagatcatgcttttgtctcctcacagttccca
gtgatcctctccattgaagagcattgctgtgtagaacagcaacgtcatatggccagggtg
tttaaggatgtatttggggacctcctccttacaaagcccactgaagccagtgccgaccag
ctgccatcccctgcccagctgaaagaaaagatcgtcatcaagcacaagaagctgggtccc
agaggagatgtggacatcaacattgaagacaagaaggaggaaaaaaagcagcaaggggaa
ttgtacatgtgggataccattgatcagaagtggtatcgccactattgtgccatagccgat
gagaagctgtccttcagtgatgttatagaacagaacgcagaggaggattcagtaaaggat
gtagcacagactgacctgcattttggtgagaagtggtttcataagaggatggagaagagg
accagtgctgagaaactgctacaggaatactgtgctgaaactgggggcaaggatggaacc
ttcttagtccgtgaaagtgaaactttccccaacgactacacactgtccttctggagatca
ggcagagtccagcactgtcgaatacggtcgactcttgagggaggagccatgaagtattat
ttaactgacaacctcatgttcaacagcatctatgacttgatccaacactaccgagaagcc
cacctgagatgtgctgaatttgagcttcgtctgacagacccagtgcccaaccccaatcct
catgaatcaaaagcttggtactatgatagcctgagcagaggagaagccgaagacatgttg
atgagaattccccgagatggagccttcctcattaggaaaagagaagggggagatgcatac
gccattactttcagagccaagggaaaagtgaaacattgccggattaacaaggatggacac
cactttgtgctggggacgtctgcttactttgaaagtttggtggaattggtcagctactat
gaaaagcatgcactttacaggaaaatgagactgcgctatcctgtgactccagagttgctg
gagcgttacaacaccgaaagggacataaattcactctatgatgtcaggatgtatgtggat
cccagtgaaattaacccctcaacgccccagagaaccgtgaaggctttgtatgactacaaa
gccaagcgtggggatgagctcagcttctgtcggggtgccctcatccacaacgtctccaag
gagcctggtggctggtggaagggtgattatggaggaaggattcagcaatattttccatct
aattatgtggaggacatatcaacagttgattttgaagagctggaaaaacagattattgaa
gataaccctttaggatctctgtgcagaggaatcttggatcttaacacctataatgttgtg
aaagtaccacatggaaaaaaccagaaaccatttgtcttcatcctggaacccaagaaaccc
aatgatcctcccatcgaatttgcgactgacaaagtggaagagctctttgagtggtaccag
agcatcagagaaatcacctggaagaatgcaacagtggagaccaacatgaagtactgggag
aagaaccaatcaattgccatagaactatccgacttagttgtctactgtaagccaacaagt
aaaaccaaggataatttagaaaatcctgattttagagaaattcgctctttcgtggagacc
aaggctgacagcattgttaggcagaagccgattgatctcttgaagtataatcaaaaggga
ttgactcgggtctacccaaaaggccaaagggtggactcatcaaattatgatccttttcga
ctttggctctgtggctctcagatggtcgctctgaatttccagacagcagataaatatatg
cagctgaatcatgctttatttgcacttaatggccggactggctatgtattgcagcctgaa
agcatgagaaatgaaaattatgatccaacacccccggaatcacaaaggaagatcctgatg
accctgacagtgaaggtcctgggggctcgccatctacccaagcttggacgaagcattgcc
tgtccatttgtagaggtggaaatttgtgggactgagtatgataacaacaaattcaagacg
actgtagtgaatgataatggcctgagtccagtctgggcgtctactcaggaaaaagtgaca
tttgaaatttatgacccaaatctcgcatttctacgttttgttgtttatgaggaggatatg
ttcagcgatcccaactttctggcacatgctacttatcccattaaaggaatcaaatcaggg
tttagagcagttcctcttaaaaatggttacagtgaagatattgagctggcctcccttctg
gttttctgtgagatgcgtcctgtcttggaaagtgaagaagagctctattcttcctgtcgc
cagcttcgaaggcgacaagaggagctgaataaccaactcttcctgtatgacactcatcag
aacttacgtaatgccagcagagatgccctggtgaatgaattcaacgtcaatgaaaatcag
ttgcagctgtatcaggaaaaatgtaaccggagattaagggagaagagagtcagtaacagc
aaattctactcctag

KEGG   Phascolarctos cinereus (koala): 110216705
Entry
110216705         CDS       T05867                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00562  Inositol phosphate metabolism
pcw01100  Metabolic pathways
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04020  Calcium signaling pathway
pcw04062  Chemokine signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04070  Phosphatidylinositol signaling system
pcw04072  Phospholipase D signaling pathway
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04658  Th1 and Th2 cell differentiation
pcw04659  Th17 cell differentiation
pcw04660  T cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04670  Leukocyte transendothelial migration
pcw04722  Neurotrophin signaling pathway
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04919  Thyroid hormone signaling pathway
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw05012  Parkinson disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05135  Yersinia infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05214  Glioma
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
pcw_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110216705 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110216705 (PLCG1)
   04014 Ras signaling pathway
    110216705 (PLCG1)
   04015 Rap1 signaling pathway
    110216705 (PLCG1)
   04370 VEGF signaling pathway
    110216705 (PLCG1)
   04064 NF-kappa B signaling pathway
    110216705 (PLCG1)
   04066 HIF-1 signaling pathway
    110216705 (PLCG1)
   04020 Calcium signaling pathway
    110216705 (PLCG1)
   04070 Phosphatidylinositol signaling system
    110216705 (PLCG1)
   04072 Phospholipase D signaling pathway
    110216705 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110216705 (PLCG1)
   04660 T cell receptor signaling pathway
    110216705 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    110216705 (PLCG1)
   04659 Th17 cell differentiation
    110216705 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    110216705 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    110216705 (PLCG1)
   04670 Leukocyte transendothelial migration
    110216705 (PLCG1)
   04062 Chemokine signaling pathway
    110216705 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    110216705 (PLCG1)
   04919 Thyroid hormone signaling pathway
    110216705 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110216705 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110216705 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    110216705 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110216705 (PLCG1)
   05206 MicroRNAs in cancer
    110216705 (PLCG1)
   05205 Proteoglycans in cancer
    110216705 (PLCG1)
   05231 Choline metabolism in cancer
    110216705 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110216705 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110216705 (PLCG1)
   05214 Glioma
    110216705 (PLCG1)
   05223 Non-small cell lung cancer
    110216705 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110216705 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    110216705 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110216705 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110216705 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110216705 (PLCG1)
   05171 Coronavirus disease - COVID-19
    110216705 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110216705 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110216705 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110216705 (PLCG1)
Enzymes [BR:pcw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     110216705 (PLCG1)
Membrane trafficking [BR:pcw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    110216705 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    110216705 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD
Other DBs
NCBI-GeneID: 110216705
NCBI-ProteinID: XP_020854262
UniProt: A0A6P5L8M2
LinkDB
Position
Unknown
AA seq 1292 aa
MMAGVGAPFANGCGSCAPSEAEALNLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQ
ITWSRGADKIEGAVDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKT
LSLQATSEDEVNMWIKGLNWLVTDTIQAATPLQIERWLRKQFYSVDRNREDRISAKDLKN
MLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMFSAQKTMDLPFLEAGTLR
GGDRPELCRVSLSEFQQFLLEYQGELWATDRLQVQEFMLSFLQDPLREIEEPYFFLDEFV
TFLFSKENNIWNSQLDSVCVDTMNNPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRM
GCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVTSEYPVILSIEDHCSI
AQQRNMAQYFKKVFGDTLLTKPVDIAADGLPSPSQLKRKILIKHKKLAEGSAYEEVPTSV
MYSENDISNSIKNGILYLEDPINHEWYPHYFVLTSSKIYYSEETNSDQGNDDEEEPKEVS
SSAELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSF
WRNGKVQHCRIHSRQDAGSPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLTEPVPQ
TNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRSEPNSYAISFRAEGKIKHCRVQQ
EGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRN
PGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQL
WFPSNYVEEMANPAALEPEREQLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSI
SMASIAHWSLDVAADSQEDLQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVIY
CRPVPFDEDKIGTERACYRDMSSFPETKAEKYVNKTKGKKFLQYNRLQLSRIYPKGQRLD
SSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMSSGRCGYVMQPGNMRDEVFDPFDK
CSLRGIEPCAVCIEVLGARHLPKNGRGIVCPFVEIEVAGADYDNMKHKTEFVVDNGLNPV
WPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFLVKGLKTGYRAVPLKNNYSED
LELASLLIKIDIFPAKQENGEVSPFGTSSFRERGSESSGQLLHGRAREGSFEARYQQPFE
DFRISQEHLADHFDSRERRALRRTRINGDNRL
NT seq 3879 nt   +upstreamnt  +downstreamnt
atgatggcaggggtgggggcccccttcgccaatggctgtgggtcctgcgccccgtcggag
gccgaggctctgaacctctgcaggagtttggaagtgggcacagtcatgaccttgttctat
tccaagaaatcccagcgaccagagaggaaaaccttccaggtcaagttggagacccggcag
atcacgtggagccgtggggcagataaaatcgagggagcggttgatattcgtgaaatcaaa
gagatccgccctgggaagacttctcgtgactttgaccgttaccaggaggacccggccttc
cggcccgaccagtcccactgctttgtcatcctgtatggcatggaattccgcctgaaaact
ctgagtctgcaagccacttcggaggatgaagtgaacatgtggatcaaaggcttgaattgg
ctcgtgactgacaccatccaggctgccacacctctgcagatcgagaggtggctccggaag
cagttctactcagtagatcggaatcgggaagacaggatttctgctaaggatcttaagaac
atgctgtcccaggtcaactaccgagtccccaacatgcggttcctgagggaacggttgacg
gacctggagcagcggagtggggacatcacctatggccagtttgcacagctctaccggagt
ctcatgttcagcgcccagaagacgatggaccttcctttcctggaagctggcaccctgagg
ggcggggatcggccagagctctgcagagtgtccctgtctgagtttcagcagtttctcctg
gaataccagggggagctgtgggccactgacaggctgcaggtgcaggagttcatgctcagc
ttcctccaggaccccctccgggagattgaggagccttatttcttcctggatgagtttgtt
accttcctgttttccaaagagaataacatctggaactcccagctggattcggtgtgcgtg
gacaccatgaacaaccccctgtctcagtactggatctcttcctcccacaacacgtacctg
accggggaccagttctccagtgagtcctccttggaggcctacgcaaggtgtcttcgtatg
ggctgtcgatgcattgagttggactgctgggatggaccagatgggatgcctgtcatttac
catggacataccctcaccaccaagattaagttctctgatgttctgcacaccattaaggag
catgcattcgtgacctcagagtatccagtgatcttgtccattgaggatcattgcagcatt
gctcagcagagaaacatggcacagtacttcaagaaagtatttggcgacaccctccttact
aagcctgtggacattgctgctgatggtctgccttcacccagccagctcaagaggaaaatc
cttatcaagcacaagaagctggccgagggcagtgcctatgaggaggtgcccacctcggtg
atgtactcagagaatgacatcagcaattccatcaagaatggcatcctctacttggaagac
cctattaaccacgagtggtacccgcactattttgtattgaccagcagcaaaatctactac
tcagaggagacaaacagtgaccagggcaacgatgatgaggaggagccaaaggaggtgagt
agcagtgcagagctgcattccagcgagaagtggttccatggcaagctcggggccggtcgg
gatgggcgccacattgctgagcgactgcttactgaatactgcattgagactggagcccct
gacggttcctttctggttcgagagagtgagacctttgtcggggactacacactgtccttc
tggcggaatgggaaggtccagcattgccggattcactcacgccaggatgctggcagcccc
aaattcttcctgacggacaacctggtatttgactcgctctatgacctcatcacccactac
cagcaggtgccactgcgatgcaacgagtttgagatgcgccttacggagcctgtgcctcaa
actaatgcccacgagagcaaagagtggtaccatgcaagtctgacccgagcccaggcggaa
cacatgttgatgcgtgtaccccgagacggggccttcctcgtgcgaaagcggagtgaaccc
aactcctatgccatctcctttcgggcagaaggaaagatcaaacactgccgcgtccagcag
gaggggcagacggtgatgctgggaaactccgagtttgacagccttgtagatctcatcagt
tactacgagaagcacccgctgtaccggaagatgaagctccggtaccccatcaatgaggag
gcactagagaaaattggcacagcggagccagactacggagccctgtatgaaggacggaat
ccaggtttctacgtggaggcaaatcctatgccaacttttaagtgtgcagtcaaagccctc
tttgactacaaggcacagcgggaagatgagctgacctttacgaagagtgccatcatccag
aatgtagaaaagcaggagggaggctggtggaggggagactatggagggaagaagcagctc
tggttcccatccaactatgtggaggagatggccaatcctgccgctttagagcctgagagg
gagcagctggatgagaacagccccctgggagatctgctccgtggagtcctggatgtgcca
gcctgtcagattgctatccgcccagagggaaagaacaaccggctgtttgtgttctcaatc
agcatggcttccattgcacattggtccctggatgtggctgcggattcacaggaggacctc
caggactgggtgaaaaagatccgagaggtggcccagactgcggatgcccggctcacagag
ggaaagatgatggaacggaggaagaaaattgccttggagctgtctgaacttgtcatctac
tgtcggcctgtccccttcgatgaggataagattggcactgagcgggcttgttaccgagac
atgtcctccttccctgaaaccaaggccgagaagtatgtgaataaaaccaagggcaagaag
ttcttgcagtataataggctccagctgtcacgcatttaccccaagggccagcggcttgac
tcctccaactatgaccctctgcccatgtggatctgtggcagccagcttgtggccctcaac
ttccagactccagacaagcccatgcagatgaaccaggccttgttcatgtccagtgggcgt
tgtgggtacgtgatgcagccaggcaacatgagagatgaagtcttcgacccctttgacaag
tgcagcttgcgtgggatagaaccgtgtgcagtctgcattgaggtcctgggggcccggcat
ctccccaagaatggccgtggcatcgtgtgtcctttcgtggagattgaagtagccggggcc
gactacgacaacatgaagcacaagacagaatttgtggtggacaacggcctgaaccctgta
tggccagcaaagcccttccacttccagattagtaaccctgagtttgctttcctgcgcttt
gtggtatatgaagaagatatgttcagtgaccagaatttcttggctcaggccaccttcctg
gtgaaaggcctgaagacaggatacagagcagtgcctttgaagaataactacagtgaggac
ttggagttggcctctctgcttatcaaaatagatatatttcctgccaagcaggagaacggt
gaagtcagcccttttggcacctcatcattccgagaacgggggtctgaatcttcaggccag
ctgctccatggacgagcccgagagggctcttttgaagcccgctatcaacagccttttgag
gacttccgcatctcccaggagcacctcgcagaccactttgacagccgagaacgaagggca
cttcggagaactcgtatcaatggagacaaccgcctctag

DBGET integrated database retrieval system