KEGG   Phascolarctos cinereus (koala): 110212842
Entry
110212842         CDS       T05867                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04060  Cytokine-cytokine receptor interaction
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04630  JAK-STAT signaling pathway
pcw04640  Hematopoietic cell lineage
pcw05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110212842 (IL3RA)
   04151 PI3K-Akt signaling pathway
    110212842 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110212842 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110212842 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110212842 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110212842 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pcw04050]
    110212842 (IL3RA)
   04090 CD molecules [BR:pcw04090]
    110212842 (IL3RA)
Cytokine receptors [BR:pcw04050]
 Interleukin receptor families
  IL3 receptor family
   110212842 (IL3RA)
CD molecules [BR:pcw04090]
 Proteins
  110212842 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind IL2RB_N1 Tissue_fac
Other DBs
NCBI-GeneID: 110212842
NCBI-ProteinID: XP_020848608
LinkDB
Position
Unknown
AA seq 390 aa
MADLITFIWFSMLLTVTYSQTPTPEDSPIKNITLDMKTMFLRWTNVENVNNISCSVKVLS
KLEYRIPAEKNECELKPDYPWCQGVDFEIEGFAGKRFLETFQIPRRGKEGTTEESLSCQV
HDANLMDCKWTVRETLRDIQYQFFYSQNANAFADRECPKYKTDSEGRHVGCHFDNLSGFT
ELEGYHFLVTGTSSGREVQCNDKYIELSKIEIFKPPNININCTNITCSIQWQIPKRRELW
ETSFEYQLQIQKVADKNILESGGPVTTKETNFDFKITDGKYTVKIRTRKLFENAPWSEWS
EPQEFGHEVHRDIPLSVLMFSLLGIAFIILLILGYLCKRYYVIQKIFPPVPRIKDQVSDS
FHQYNEVLWEENKILPEQCKIEEIQVIGKK
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggcagatctgataaccttcatttggttctcaatgttactaaccgtaacatacagccaa
acaccaacaccggaggattcgccaattaaaaatataactttggatatgaagacaatgttc
ctgagatggaccaatgtggagaatgtgaataacatcagctgttctgttaaagtgctctca
aaattagaatatcgcataccggcagaaaaaaacgagtgtgaactaaagcccgattatcct
tggtgccaaggggtagactttgaaattgagggatttgctggcaaaagatttttagaaaca
ttccagattccccgaagaggaaaagaagggaccactgaagaaagtttatcctgccaggtt
catgatgcaaatctcatggactgcaaatggacagtgagagaaactctaagggatatccag
tatcaatttttttactcacaaaatgcaaatgcttttgcagatagagaatgtccaaaatac
aagacagattctgaaggaagacatgttggatgtcattttgataacctgtcaggattcaca
gagcttgaagggtatcacttcctagtaacaggaaccagcagtggaagggaagtccagtgt
aatgataagtacattgaactaagtaaaattgaaatatttaaaccaccaaatatcaatata
aactgcacaaatattacttgtagcatacaatggcagatacccaaaagaagagaattgtgg
gagacaagctttgaatatcagcttcaaattcaaaaggttgctgacaagaatatcttagaa
tcaggaggccctgttactacaaaagaaacgaattttgacttcaaaattactgatggaaaa
tatactgtgaaaataagaacaagaaagctgtttgaaaatgcaccttggagtgaatggagt
gagcctcaagaatttggtcatgaagtccacagagatattcctctgtcagtattaatgttc
tcacttcttggaatagccttcattatcctgctcattttgggatatctctgtaaaaggtat
tatgtgattcaaaaaatattccctcctgttccccgtattaaagaccaagttagtgacagt
tttcaccaatacaatgaggtgctctgggaagaaaataaaatacttccagaacaatgtaaa
attgaagagatacaggtcatagggaaaaaataa

DBGET integrated database retrieval system