Phascolarctos cinereus (koala): 110213115 Help Entry 110213115         CDS       T05867                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01521   EGFR tyrosine kinase inhibitor resistance pcw01523   Antifolate resistance pcw04060   Cytokine-cytokine receptor interaction pcw04061   Viral protein interaction with cytokine and cytokine receptor pcw04066   HIF-1 signaling pathway pcw04068   FoxO signaling pathway pcw04151   PI3K-Akt signaling pathway pcw04218   Cellular senescence pcw04620   Toll-like receptor signaling pathway pcw04621   NOD-like receptor signaling pathway pcw04623   Cytosolic DNA-sensing pathway pcw04625   C-type lectin receptor signaling pathway pcw04630   JAK-STAT signaling pathway pcw04640   Hematopoietic cell lineage pcw04657   IL-17 signaling pathway pcw04659   Th17 cell differentiation pcw04668   TNF signaling pathway pcw04672   Intestinal immune network for IgA production pcw04931   Insulin resistance pcw04932   Non-alcoholic fatty liver disease pcw04933   AGE-RAGE signaling pathway in diabetic complications pcw04936   Alcoholic liver disease pcw05010   Alzheimer disease pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05132   Salmonella infection pcw05133   Pertussis pcw05134   Legionellosis pcw05135   Yersinia infection pcw05142   Chagas disease pcw05143   African trypanosomiasis pcw05144   Malaria pcw05146   Amoebiasis pcw05152   Tuberculosis pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05166   Human T-cell leukemia virus 1 infection pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05171   Coronavirus disease - COVID-19 pcw05200   Pathways in cancer pcw05202   Transcriptional misregulation in cancer pcw05321   Inflammatory bowel disease pcw05323   Rheumatoid arthritis pcw05332   Graft-versus-host disease pcw05410   Hypertrophic cardiomyopathy pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110213115 (IL6)    04668 TNF signaling pathway     110213115 (IL6)    04066 HIF-1 signaling pathway     110213115 (IL6)    04068 FoxO signaling pathway     110213115 (IL6)    04151 PI3K-Akt signaling pathway     110213115 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110213115 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     110213115 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     110213115 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110213115 (IL6)    04620 Toll-like receptor signaling pathway     110213115 (IL6)    04621 NOD-like receptor signaling pathway     110213115 (IL6)    04623 Cytosolic DNA-sensing pathway     110213115 (IL6)    04625 C-type lectin receptor signaling pathway     110213115 (IL6)    04659 Th17 cell differentiation     110213115 (IL6)    04657 IL-17 signaling pathway     110213115 (IL6)    04672 Intestinal immune network for IgA production     110213115 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110213115 (IL6)    05202 Transcriptional misregulation in cancer     110213115 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110213115 (IL6)    05161 Hepatitis B     110213115 (IL6)    05171 Coronavirus disease - COVID-19     110213115 (IL6)    05164 Influenza A     110213115 (IL6)    05162 Measles     110213115 (IL6)    05168 Herpes simplex virus 1 infection     110213115 (IL6)    05163 Human cytomegalovirus infection     110213115 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     110213115 (IL6)    05169 Epstein-Barr virus infection     110213115 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     110213115 (IL6)    05135 Yersinia infection     110213115 (IL6)    05133 Pertussis     110213115 (IL6)    05134 Legionellosis     110213115 (IL6)    05152 Tuberculosis     110213115 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     110213115 (IL6)    05144 Malaria     110213115 (IL6)    05142 Chagas disease     110213115 (IL6)    05143 African trypanosomiasis     110213115 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     110213115 (IL6)    05321 Inflammatory bowel disease     110213115 (IL6)    05332 Graft-versus-host disease     110213115 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     110213115 (IL6)    05020 Prion disease     110213115 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     110213115 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110213115 (IL6)    05410 Hypertrophic cardiomyopathy     110213115 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110213115 (IL6)    04932 Non-alcoholic fatty liver disease     110213115 (IL6)    04931 Insulin resistance     110213115 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     110213115 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110213115 (IL6)    01523 Antifolate resistance     110213115 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110213115 (IL6) Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Interleukins    110213115 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF Motif Other DBs NCBI-GeneID:  110213115 NCBI-ProteinID:  XP_020849025 UniProt:  A0A6P5KTA4 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MNPLLRITGSLRPLALILILLMSTAAVPIPDSLGDGSPGDEVITKSSSNPDLEIAKQLHT TASELKNKMCQTQNLCDDSNEALAENNLNLPNITERDGCLTTGFNEETCLPRIVSGLQEF DTYLRYMETEMKDNKLQYLRMGTVQLIHKLKLLIKKTDAVPTPDPIVSKNLLSELQSLKA WSKNMALRLILWHYTRFMEGTIRVVRFLHTRSIAA NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgaaccctctgctccgaatcacaggatctcttaggccacttgccctcattctgatactc ctcatgtccacggctgctgtccccatcccagattccttgggggacggatctccaggggat gaggtcataacgaaatcatccagcaatcctgatcttgaaattgcaaagcagctccatacg acggctagtgaacttaaaaataagatgtgtcagacccagaacctgtgtgacgatagcaat gaggcactagccgaaaataacctgaaccttcccaacatcacagagagagatggatgcttg actactggattcaatgaggagacatgcttgccaaggattgtgagtggtcttcaggagttt gacacgtatcttcggtacatggaaacagagatgaaggataataagttacaatacctaaga atgggtacagttcagctcatccacaaactgaagctcttgataaaaaagacggatgcagta cccacccccgacccaattgtctccaagaacctgctttctgagctgcaatccctgaaagcc tggtccaagaacatggctctccgtctcatcctgtggcactacacccgcttcatggagggc accatccgggtggttcggtttctacacactaggagtattgctgcctga

DBGET integrated database retrieval system