KEGG   Phascolarctos cinereus (koala): 110213446
Entry
110213446         CDS       T05867                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein isoform X1
  KO
K06618  retinoblastoma-associated protein
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw04110  Cell cycle
pcw04218  Cellular senescence
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05212  Pancreatic cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110213446 (RB1)
   04218 Cellular senescence
    110213446 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110213446 (RB1)
   05203 Viral carcinogenesis
    110213446 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110213446 (RB1)
   05225 Hepatocellular carcinoma
    110213446 (RB1)
   05226 Gastric cancer
    110213446 (RB1)
   05214 Glioma
    110213446 (RB1)
   05220 Chronic myeloid leukemia
    110213446 (RB1)
   05218 Melanoma
    110213446 (RB1)
   05219 Bladder cancer
    110213446 (RB1)
   05215 Prostate cancer
    110213446 (RB1)
   05224 Breast cancer
    110213446 (RB1)
   05222 Small cell lung cancer
    110213446 (RB1)
   05223 Non-small cell lung cancer
    110213446 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110213446 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110213446 (RB1)
   05161 Hepatitis B
    110213446 (RB1)
   05160 Hepatitis C
    110213446 (RB1)
   05163 Human cytomegalovirus infection
    110213446 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110213446 (RB1)
   05169 Epstein-Barr virus infection
    110213446 (RB1)
   05165 Human papillomavirus infection
    110213446 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110213446 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcw01009]
    110213446 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110213446 (RB1)
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110213446 (RB1)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    110213446 (RB1)
SSDB
Motif
Pfam: RB_A Rb_C RB_B DUF3452
Other DBs
NCBI-GeneID: 110213446
NCBI-ProteinID: XP_020849453
UniProt: A0A6P5KUM8
LinkDB
Position
Unknown
AA seq 975 aa
MPPKAPRKPAVSTPEPPPPPSPPPREEEPEPDSGPEDLPLVRLEFEEAEDPDFTTLCQKL
KIPNHVRKKAWENWEKVSSMDGILECYIQKKKELWGICIFTAAIDLDEMPFTFTELQKNI
DISVHKFYYLLREIDTSTKVDCTVSRLMKKYDVLFALYHKLERTCGLIYVAQPSSPISSE
INSMLVLKVSWILFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPAVLKEPYKTAVS
TLSINGSPRTPRRGQNRSARIARQPETDTRVIEVLCKEHECNIDEVKNVYFKNFLPFLKS
LGIAASNGLPEVENLSKQYEEIYLKNKDMDARLFLDHDKTLQVDSIDSFEMERMPRKNHP
DEEMPLIPPQTPVRAVMNTIQQLVMILNSASDQPSENLITYFNNCTVNPKESILKRVENI
GRIFKEKFAEAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIF
HTSLLACAVEVVMATYGRSTYQSHDSGTDLSFPWILNVLDLKAFDFYKVIESFIKAEASL
TREMIKHLERCEHRIMESLAWQSDSPLFDLIKQSKEREGPVDHLLEPASTLNLPLQHNHT
AADLYLSPVRSPKKKGSTARVNSTSNAEPQTTSASQTQKPPKSTSLSLFYKKVYRLAYLR
LNTLCSRLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKF
KIIVTAYKDLTHAIQETFKRVLIREGQYDSIIVFYNLVFMQKLKTNILQYASTRPPTLSP
IPHIPRSPYKFSSSPLRVPGGNIYISPLKSPYKFSEGLPTPTKMTPRSRILVSIGESFGT
SEKFQKINQMVCSSDRLLKRSAEASNPPKPLKKLRFDIEGPDEADGSKHLSGESKFQQKL
AEMRNLGLHPSKLCHLQVGPSLCILDLHKRLFPSLFSTVPLPYLHVIHLGLECLESKCVV
SIVLDGEKILLYKSL
NT seq 2928 nt   +upstreamnt  +downstreamnt
atgccacccaaagcccctcgcaaaccggctgtttcgaccccggagccgccgccgccgcct
tcccctccccctcgcgaggaggaaccggagccggacagcggcccagaggacctgcctctc
gtcaggcttgaatttgaagaagcagaagaccctgattttactacattatgtcagaaacta
aagataccaaatcatgtcaggaaaaaggcttgggagaattgggaaaaagtttcatctatg
gatggaattttggaatgttatattcaaaagaaaaaggaattatggggaatttgtatattc
actgcagctatagatctagatgagatgccattcacctttactgaacttcagaagaacata
gatataagtgtgcacaaattttattatttgctaagagaaattgataccagtactaaagtt
gactgtactgtatccagattaatgaagaaatatgatgttttatttgcactctaccacaaa
ctggaaaggacatgtggacttatatatgtggctcaacctagtagtccgatatcttctgaa
ataaattctatgttggtgctaaaagtttcttggatcttgtttttgttggctaaaggggaa
gtattacagatggaggatgatctggtgatttcatttcagttaatgttgtgtgtccttgac
tattttatcaaactctcacctcctgcagtgctcaaggagccatataaaactgcagtgagt
acattatctattaatggttcacccagaacaccaaggcgaggtcaaaacaggagtgcacgg
atagcaagacaaccagagactgacacgagagtcattgaagttctttgtaaagagcatgaa
tgtaatattgatgaggtaaaaaatgtatatttcaaaaactttctacccttcctgaagtct
cttggtattgcagcttctaatggattaccagaggttgaaaatctctctaaacaatatgaa
gaaatttaccttaaaaacaaagatatggatgcaagactctttctggatcatgataaaact
cttcaagttgattctattgatagttttgaaatggagaggatgccaagaaaaaatcatcct
gatgaagagatgcctctaattcctccacagactcctgttagggctgtcatgaatactatc
caacagttggtgatgatactaaattcagcaagtgaccaaccatcagaaaatcttatcact
tatttcaataattgtacagtcaatcctaaggaaagtatcctgaaaagagtagagaatatt
ggacgcatctttaaagagaaatttgctgaggctgttggacagggatgtgtagaaattgga
tcacagcgatacaaacttggagtgcgattatactacagagttatggaatctatgcttaaa
tcagaagaagaacgtttatctattcagaacttcagcaaacttctcaatgataacatcttc
catacatcgctgttggcttgcgctgtcgaggttgtaatggccacatatggcaggagtaca
taccagagtcatgattccggaacagatttgtcttttccatggattctgaatgtacttgat
ttaaaagcatttgatttttacaaagtgattgaaagctttatcaaggcagaagctagtttg
acgagggaaatgataaaacatttagaacgttgtgaacatcggatcatggagtcactagca
tggcaatcagattcacctttatttgatctcattaaacaatcgaaggaacgagaaggacca
gttgatcacctccttgaacctgcttctactcttaatctgcctctccagcataatcacact
gctgcagatctgtatctttctcctgtaagatcccccaagaaaaaaggatccacagctcga
gtaaattccacttcaaatgcagaaccacagacaacatcagcctctcaaactcagaagcca
ccgaaatctacctccctttcactcttttacaaaaaagtgtatcggttggcatatctccgg
ctgaatactctgtgttcacgacttctgtcagatcaccctgaactggagcacatcatttgg
acccttttccaacacactctacaaaacgagtatgaactcatgagggacaggcatttggac
cagattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagatcttaaattc
aaaatcattgttactgcatataaggaccttacccatgccatccaggagactttcaaacgt
gttttgatcagagaagggcagtatgattccattatagtcttctacaatttggtcttcatg
cagaaactaaaaacaaatattctacaatatgcttccaccaggcccccaaccttatcaccg
atacctcacattcctcggagtccttataagttttctagttctcctttacgtgttcctgga
gggaatatttatatatcacctttgaagagtccatacaaattttcagaaggcctgccaact
cccacaaaaatgactccaagatcaagaatcttggtttcaattggtgaatcatttggcact
tctgagaagtttcagaaaataaaccagatggtgtgtagcagtgatcgtttgctcaagaga
agtgctgaagcaagcaaccctcctaaaccacttaaaaaactacgctttgatattgaagga
ccggatgaagcagatggaagcaaacatctctctggggaatccaaatttcaacaaaaactt
gcagaaatgagaaacttaggactccatccctcaaaattatgccacctccaggttggacct
tctctatgtatactggatctacataagcggctcttcccatctttgttttctacagtgcca
ttgccatatcttcatgttatccatttgggcctggagtgtttggagtccaaatgtgttgtc
tccattgtccttgatggtgaaaagattttattatataaatctttatag

DBGET integrated database retrieval system