KEGG   Phascolarctos cinereus (koala): 110214622
Entry
110214622         CDS       T05867                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04020  Calcium signaling pathway
pcw04062  Chemokine signaling pathway
pcw04064  NF-kappa B signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04070  Phosphatidylinositol signaling system
pcw04071  Sphingolipid signaling pathway
pcw04150  mTOR signaling pathway
pcw04270  Vascular smooth muscle contraction
pcw04310  Wnt signaling pathway
pcw04370  VEGF signaling pathway
pcw04510  Focal adhesion
pcw04540  Gap junction
pcw04613  Neutrophil extracellular trap formation
pcw04650  Natural killer cell mediated cytotoxicity
pcw04662  B cell receptor signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04670  Leukocyte transendothelial migration
pcw04713  Circadian entrainment
pcw04720  Long-term potentiation
pcw04723  Retrograde endocannabinoid signaling
pcw04724  Glutamatergic synapse
pcw04725  Cholinergic synapse
pcw04726  Serotonergic synapse
pcw04727  GABAergic synapse
pcw04728  Dopaminergic synapse
pcw04730  Long-term depression
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04911  Insulin secretion
pcw04912  GnRH signaling pathway
pcw04916  Melanogenesis
pcw04918  Thyroid hormone synthesis
pcw04919  Thyroid hormone signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04925  Aldosterone synthesis and secretion
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04929  GnRH secretion
pcw04931  Insulin resistance
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw04960  Aldosterone-regulated sodium reabsorption
pcw04961  Endocrine and other factor-regulated calcium reabsorption
pcw04970  Salivary secretion
pcw04971  Gastric acid secretion
pcw04972  Pancreatic secretion
pcw04973  Carbohydrate digestion and absorption
pcw05017  Spinocerebellar ataxia
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05031  Amphetamine addiction
pcw05032  Morphine addiction
pcw05140  Leishmaniasis
pcw05143  African trypanosomiasis
pcw05146  Amoebiasis
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05214  Glioma
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
pcw05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110214622 (PRKCB)
   04012 ErbB signaling pathway
    110214622 (PRKCB)
   04014 Ras signaling pathway
    110214622 (PRKCB)
   04015 Rap1 signaling pathway
    110214622 (PRKCB)
   04310 Wnt signaling pathway
    110214622 (PRKCB)
   04370 VEGF signaling pathway
    110214622 (PRKCB)
   04064 NF-kappa B signaling pathway
    110214622 (PRKCB)
   04066 HIF-1 signaling pathway
    110214622 (PRKCB)
   04020 Calcium signaling pathway
    110214622 (PRKCB)
   04070 Phosphatidylinositol signaling system
    110214622 (PRKCB)
   04071 Sphingolipid signaling pathway
    110214622 (PRKCB)
   04150 mTOR signaling pathway
    110214622 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110214622 (PRKCB)
   04540 Gap junction
    110214622 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110214622 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    110214622 (PRKCB)
   04662 B cell receptor signaling pathway
    110214622 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    110214622 (PRKCB)
   04670 Leukocyte transendothelial migration
    110214622 (PRKCB)
   04062 Chemokine signaling pathway
    110214622 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    110214622 (PRKCB)
   04929 GnRH secretion
    110214622 (PRKCB)
   04912 GnRH signaling pathway
    110214622 (PRKCB)
   04921 Oxytocin signaling pathway
    110214622 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    110214622 (PRKCB)
   04918 Thyroid hormone synthesis
    110214622 (PRKCB)
   04919 Thyroid hormone signaling pathway
    110214622 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    110214622 (PRKCB)
   04916 Melanogenesis
    110214622 (PRKCB)
   04925 Aldosterone synthesis and secretion
    110214622 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110214622 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    110214622 (PRKCB)
   04971 Gastric acid secretion
    110214622 (PRKCB)
   04972 Pancreatic secretion
    110214622 (PRKCB)
   04973 Carbohydrate digestion and absorption
    110214622 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110214622 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110214622 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    110214622 (PRKCB)
   04727 GABAergic synapse
    110214622 (PRKCB)
   04725 Cholinergic synapse
    110214622 (PRKCB)
   04728 Dopaminergic synapse
    110214622 (PRKCB)
   04726 Serotonergic synapse
    110214622 (PRKCB)
   04720 Long-term potentiation
    110214622 (PRKCB)
   04730 Long-term depression
    110214622 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    110214622 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110214622 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110214622 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110214622 (PRKCB)
   05206 MicroRNAs in cancer
    110214622 (PRKCB)
   05205 Proteoglycans in cancer
    110214622 (PRKCB)
   05231 Choline metabolism in cancer
    110214622 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110214622 (PRKCB)
   05214 Glioma
    110214622 (PRKCB)
   05223 Non-small cell lung cancer
    110214622 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110214622 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    110214622 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    110214622 (PRKCB)
   05032 Morphine addiction
    110214622 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110214622 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110214622 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110214622 (PRKCB)
   05161 Hepatitis B
    110214622 (PRKCB)
   05171 Coronavirus disease - COVID-19
    110214622 (PRKCB)
   05164 Influenza A
    110214622 (PRKCB)
   05163 Human cytomegalovirus infection
    110214622 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110214622 (PRKCB)
   05140 Leishmaniasis
    110214622 (PRKCB)
   05143 African trypanosomiasis
    110214622 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110214622 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110214622 (PRKCB)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110214622 (PRKCB)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110214622 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 110214622
NCBI-ProteinID: XP_020851284
UniProt: A0A6P5L3E8
LinkDB
Position
Unknown
AA seq 673 aa
MADPAAVPPPSEGEENTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIKAQIDKDVLTVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFKFQLKEADKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEE
LRQKFERAKISQVNKVTEEKTANAISKIDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALAGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgccgtgccgccgccgagcgaaggcgaagagaacacggtccgcttc
gcccgcaaaggggccctccggcagaagaacgtccacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggattc
ggaaaacagggatttcagtgtcaagtgtgctgttttgtagttcataagagatgccatgaa
tttgtcaccttctcctgcccgggtgctgataagggcccagcctctgatgatccccggagc
aagcacaagtttaaaatccacacttactccagtccaacattctgtgatcactgcggctct
ttgctgtatgggctcattcaccaaggaatgaaatgtgacacctgcatgatgaacgtgcac
aaacgctgtgtgatgaatgtccccagcctctgcggaacagaccacactgagcgtcgagga
cggatctacatcaaagcccagattgacaaagacgttctcactgttgttgtaagagatgca
aaaaatctagtacctatggaccctaatggtctatcagatccttatgtgaaactgaaactc
atccctgatcccaagagtgagagcaagcagaagaccaaaaccatcaagtgttccctcaac
cctgagtggaatgagacttttaagtttcaactgaaagaagctgacaaagacagacgactt
tctgtggagatttgggactgggatctgaccagcaggaatgatttcatggggtccttgtcc
tttgggatctcagagctgcagaaagctggtgttgatggatggtttaaattactaagtcaa
gaggaaggagagtattttaatgttccagttcctcctgaaggagaagagggcaatgaagag
ctccggcagaaatttgagagggccaagattagccaggtaaacaaggttaccgaagaaaag
acagccaatgcaatatctaaaattgacaacaatggaaaccgagatcggatgaaactgact
gattttaacttcctcatggtgctggggaaaggcagctttggcaaggtcatgctttcagaa
agaaaaggcacagatgaactctatgctgtgaagatcctgaagaaagatgtcgtgatccag
gatgatgatgtggaatgtacaatggtggagaagagggtgcttgctcttgctgggaagcct
ccattcctgacacagctacactcctgtttccagacaatggatcgcctatattttgtgatg
gaatatgtgaatggtggagatctcatgtaccagatccagcaggttggacgatttaaggag
ccccatgccgtattctatgcagcagaaattgctatcggtcttttcttcttacaaagcaaa
ggcatcatttatcgagacctaaaactcgacaacgtaatgttggattctgaaggccacatc
aagatcgctgacttcggcatgtgcaaggagaacatctgggatggggtgaccaccaagaca
ttctgtggcactccagactacattgctcctgagataattgcctatcaaccttacgggaag
tcggtagattggtgggcatttggagtgctgctgtatgaaatgttggctggtcaggctcct
tttgaaggagaagatgaagatgaacttttccagtctatcatggagcacaatgtggcctat
cccaagtctatgtcaaaggaagctgtggccatctgcaaagggctaatgaccaagcacccc
gggaaacgtctgggatgtgggcctgaaggtgaacgagatattaaggaacatgcatttttc
cggtatattgactgggagaaacttgaacgcaaggagattcagcccccatacaagccaaaa
gcttgtgggcgaaatgccgaaaacttcgaccggtttttcacccgccatccacctgtccta
acacctcctgaccaggaagtcatcaggaacattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

KEGG   Phascolarctos cinereus (koala): 110218307
Entry
110218307         CDS       T05867                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04020  Calcium signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04070  Phosphatidylinositol signaling system
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04270  Vascular smooth muscle contraction
pcw04310  Wnt signaling pathway
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04510  Focal adhesion
pcw04540  Gap junction
pcw04613  Neutrophil extracellular trap formation
pcw04650  Natural killer cell mediated cytotoxicity
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04670  Leukocyte transendothelial migration
pcw04713  Circadian entrainment
pcw04720  Long-term potentiation
pcw04723  Retrograde endocannabinoid signaling
pcw04724  Glutamatergic synapse
pcw04725  Cholinergic synapse
pcw04726  Serotonergic synapse
pcw04727  GABAergic synapse
pcw04728  Dopaminergic synapse
pcw04730  Long-term depression
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04911  Insulin secretion
pcw04912  GnRH signaling pathway
pcw04916  Melanogenesis
pcw04918  Thyroid hormone synthesis
pcw04919  Thyroid hormone signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04925  Aldosterone synthesis and secretion
pcw04926  Relaxin signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04929  GnRH secretion
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw04960  Aldosterone-regulated sodium reabsorption
pcw04961  Endocrine and other factor-regulated calcium reabsorption
pcw04970  Salivary secretion
pcw04971  Gastric acid secretion
pcw04972  Pancreatic secretion
pcw05017  Spinocerebellar ataxia
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05031  Amphetamine addiction
pcw05032  Morphine addiction
pcw05143  African trypanosomiasis
pcw05146  Amoebiasis
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05214  Glioma
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
pcw05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110218307 (PRKCA)
   04012 ErbB signaling pathway
    110218307 (PRKCA)
   04014 Ras signaling pathway
    110218307 (PRKCA)
   04015 Rap1 signaling pathway
    110218307 (PRKCA)
   04310 Wnt signaling pathway
    110218307 (PRKCA)
   04370 VEGF signaling pathway
    110218307 (PRKCA)
   04066 HIF-1 signaling pathway
    110218307 (PRKCA)
   04020 Calcium signaling pathway
    110218307 (PRKCA)
   04070 Phosphatidylinositol signaling system
    110218307 (PRKCA)
   04072 Phospholipase D signaling pathway
    110218307 (PRKCA)
   04071 Sphingolipid signaling pathway
    110218307 (PRKCA)
   04151 PI3K-Akt signaling pathway
    110218307 (PRKCA)
   04150 mTOR signaling pathway
    110218307 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110218307 (PRKCA)
   04540 Gap junction
    110218307 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110218307 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    110218307 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    110218307 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    110218307 (PRKCA)
   04670 Leukocyte transendothelial migration
    110218307 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    110218307 (PRKCA)
   04929 GnRH secretion
    110218307 (PRKCA)
   04912 GnRH signaling pathway
    110218307 (PRKCA)
   04921 Oxytocin signaling pathway
    110218307 (PRKCA)
   04926 Relaxin signaling pathway
    110218307 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    110218307 (PRKCA)
   04918 Thyroid hormone synthesis
    110218307 (PRKCA)
   04919 Thyroid hormone signaling pathway
    110218307 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    110218307 (PRKCA)
   04916 Melanogenesis
    110218307 (PRKCA)
   04925 Aldosterone synthesis and secretion
    110218307 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110218307 (PRKCA)
   04270 Vascular smooth muscle contraction
    110218307 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    110218307 (PRKCA)
   04971 Gastric acid secretion
    110218307 (PRKCA)
   04972 Pancreatic secretion
    110218307 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110218307 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110218307 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    110218307 (PRKCA)
   04727 GABAergic synapse
    110218307 (PRKCA)
   04725 Cholinergic synapse
    110218307 (PRKCA)
   04728 Dopaminergic synapse
    110218307 (PRKCA)
   04726 Serotonergic synapse
    110218307 (PRKCA)
   04720 Long-term potentiation
    110218307 (PRKCA)
   04730 Long-term depression
    110218307 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    110218307 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110218307 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    110218307 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110218307 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110218307 (PRKCA)
   05206 MicroRNAs in cancer
    110218307 (PRKCA)
   05205 Proteoglycans in cancer
    110218307 (PRKCA)
   05231 Choline metabolism in cancer
    110218307 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110218307 (PRKCA)
   05214 Glioma
    110218307 (PRKCA)
   05223 Non-small cell lung cancer
    110218307 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110218307 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    110218307 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    110218307 (PRKCA)
   05032 Morphine addiction
    110218307 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110218307 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110218307 (PRKCA)
   05161 Hepatitis B
    110218307 (PRKCA)
   05171 Coronavirus disease - COVID-19
    110218307 (PRKCA)
   05164 Influenza A
    110218307 (PRKCA)
   05163 Human cytomegalovirus infection
    110218307 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110218307 (PRKCA)
   05143 African trypanosomiasis
    110218307 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110218307 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110218307 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110218307 (PRKCA)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110218307 (PRKCA)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110218307 (PRKCA)
Membrane trafficking [BR:pcw04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    110218307 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2
Other DBs
NCBI-GeneID: 110218307
NCBI-ProteinID: XP_020856594
UniProt: A0A6P5LJ25
LinkDB
Position
Unknown
AA seq 674 aa
MADVFSVNDSTESLDVANRFARKGALRQKNVHEVKDHRFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLLHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTGEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPTDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSDDRKSNIPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADR
KGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVME
YVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKQGIIYRDLKLDNVMLDSEGHIK
IADFGMCKEHMLDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPF
DGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGSEGERDIREHAFFR
RIDWDKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQADFEGFSY
VNPQFLHPILQSSV
NT seq 2025 nt   +upstreamnt  +downstreamnt
atggccgacgttttctcggtcaacgactccacagagtctctggacgtggccaaccgcttc
gcccgcaaaggggcgctaaggcagaagaacgtgcacgaagtcaaggaccacagattcatc
gcccgcttcttcaagcagcccaccttctgcagccattgcactgacttcatctgggggttt
ggaaaacaaggtttccagtgccaagtttgctgttttgtcgttcacaagaggtgccatgaa
tttgtcactttctcttgtccgggtgcagataaaggacctgacactgatgaccccagaagt
aagcacaagtttaaaatccacacatatggaagccctacattttgtgatcactgtggctca
ctgctctatggacttctacatcaagggatgaaatgtgacacttgtgatatgaatgttcac
aaacaatgtgtaataaatgttccaagcctctgtggaatggaccatacagaaaaaagaggg
cgaatttatctgaaagcggaagtcacaggtgaaaaactacatgtcacagtacgagatgca
aaaaacttaatccctatggatccaaatggactttcagatccctatgtgaagctgaaactt
atcccagaccctaagaatgaaagtaaacaaaaaaccaagacgatccgctccacactaaac
ccacagtggaatgagtcattcacattcaaattaaaacctacagataaagatagacggcta
tctgtcgagatctgggactgggatcgaacaacaagaaatgattttatgggctcactttca
tttggggtatcggagcttatgaaaatgccagcaagtggatggtataagttgcttaatcaa
gaagaaggtgaatactacaatgtgcccattccagaaggagatgaagaaggaaatatggaa
ctgaggcagaagtttgaaaaagccaagcttggccctgctggtaacaaggtgatcagtcca
tcagatgacagaaaatccaatataccatccaacaaccttgacagagtcaaactcacagac
tttaattttctcatggtcctggggaagggtagttttggaaaggtgatgttggctgaccga
aaggggacagaagaactatatgcgatcaaaattttgaaaaaagatgtggtgatacaagat
gatgatgttgaatgcacgatggtagaaaagagagtactggctctcctagacaaacctcct
ttcttaacacaattgcactcctgcttccagacagtcgatcgtctttattttgtcatggaa
tatgtcaatggcggagacctcatgtaccacattcagcaagtaggaaagtttaaggagcca
caagcagtgttctatgcagcagagatttcaattggattattcttccttcataaacaaggg
atcatttatagagatttgaaattagacaatgtcatgttggattcagaaggacatatcaag
attgctgattttggaatgtgcaaggagcatatgttagatggagtcacaaccaggacattc
tgtggaactccggattacattgccccagagatcattgcttatcagccgtatggaaaatct
gtggactggtgggcctatggtgtcctgttatatgaaatgttagctggacagcccccattt
gatggtgaagatgaggatgaactcttccaatccataatggaacacaatgtttcctatcca
aaatcattgtccaaagaagctgtttccatctgcaaaggactaatgacaaagcaccctgca
aaacgcctgggttgtgggtctgagggagaaagggacatcagagaacatgcatttttcaga
agaattgactgggacaaactggagaacagagaaatccaaccaccgttcaaacctaaagtg
tgtggcaaaggagcagaaaactttgacaaattcttcacacgagggcagccggtgttaaca
ccacctgatcaactggtcattgctaacatagaccaagccgattttgaagggttctcttat
gtcaatccacagtttctccaccccatcttgcagagctcggtatga

KEGG   Phascolarctos cinereus (koala): 110220182
Entry
110220182         CDS       T05867                                 

Gene name
PRKCG
Definition
(RefSeq) LOW QUALITY PROTEIN: protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04020  Calcium signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04070  Phosphatidylinositol signaling system
pcw04071  Sphingolipid signaling pathway
pcw04150  mTOR signaling pathway
pcw04270  Vascular smooth muscle contraction
pcw04310  Wnt signaling pathway
pcw04370  VEGF signaling pathway
pcw04510  Focal adhesion
pcw04540  Gap junction
pcw04613  Neutrophil extracellular trap formation
pcw04650  Natural killer cell mediated cytotoxicity
pcw04666  Fc gamma R-mediated phagocytosis
pcw04670  Leukocyte transendothelial migration
pcw04713  Circadian entrainment
pcw04720  Long-term potentiation
pcw04723  Retrograde endocannabinoid signaling
pcw04724  Glutamatergic synapse
pcw04725  Cholinergic synapse
pcw04726  Serotonergic synapse
pcw04727  GABAergic synapse
pcw04728  Dopaminergic synapse
pcw04730  Long-term depression
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04911  Insulin secretion
pcw04916  Melanogenesis
pcw04918  Thyroid hormone synthesis
pcw04919  Thyroid hormone signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04925  Aldosterone synthesis and secretion
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04929  GnRH secretion
pcw04935  Growth hormone synthesis, secretion and action
pcw04960  Aldosterone-regulated sodium reabsorption
pcw04961  Endocrine and other factor-regulated calcium reabsorption
pcw04970  Salivary secretion
pcw04971  Gastric acid secretion
pcw04972  Pancreatic secretion
pcw05017  Spinocerebellar ataxia
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05031  Amphetamine addiction
pcw05032  Morphine addiction
pcw05143  African trypanosomiasis
pcw05146  Amoebiasis
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05214  Glioma
pcw05223  Non-small cell lung cancer
pcw05225  Hepatocellular carcinoma
pcw05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110220182 (PRKCG)
   04012 ErbB signaling pathway
    110220182 (PRKCG)
   04014 Ras signaling pathway
    110220182 (PRKCG)
   04015 Rap1 signaling pathway
    110220182 (PRKCG)
   04310 Wnt signaling pathway
    110220182 (PRKCG)
   04370 VEGF signaling pathway
    110220182 (PRKCG)
   04066 HIF-1 signaling pathway
    110220182 (PRKCG)
   04020 Calcium signaling pathway
    110220182 (PRKCG)
   04070 Phosphatidylinositol signaling system
    110220182 (PRKCG)
   04071 Sphingolipid signaling pathway
    110220182 (PRKCG)
   04150 mTOR signaling pathway
    110220182 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110220182 (PRKCG)
   04540 Gap junction
    110220182 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110220182 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    110220182 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    110220182 (PRKCG)
   04670 Leukocyte transendothelial migration
    110220182 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    110220182 (PRKCG)
   04929 GnRH secretion
    110220182 (PRKCG)
   04921 Oxytocin signaling pathway
    110220182 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    110220182 (PRKCG)
   04918 Thyroid hormone synthesis
    110220182 (PRKCG)
   04919 Thyroid hormone signaling pathway
    110220182 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    110220182 (PRKCG)
   04916 Melanogenesis
    110220182 (PRKCG)
   04925 Aldosterone synthesis and secretion
    110220182 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110220182 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    110220182 (PRKCG)
   04971 Gastric acid secretion
    110220182 (PRKCG)
   04972 Pancreatic secretion
    110220182 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110220182 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110220182 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    110220182 (PRKCG)
   04727 GABAergic synapse
    110220182 (PRKCG)
   04725 Cholinergic synapse
    110220182 (PRKCG)
   04728 Dopaminergic synapse
    110220182 (PRKCG)
   04726 Serotonergic synapse
    110220182 (PRKCG)
   04720 Long-term potentiation
    110220182 (PRKCG)
   04730 Long-term depression
    110220182 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    110220182 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110220182 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110220182 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110220182 (PRKCG)
   05206 MicroRNAs in cancer
    110220182 (PRKCG)
   05205 Proteoglycans in cancer
    110220182 (PRKCG)
   05231 Choline metabolism in cancer
    110220182 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110220182 (PRKCG)
   05214 Glioma
    110220182 (PRKCG)
   05223 Non-small cell lung cancer
    110220182 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    110220182 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    110220182 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    110220182 (PRKCG)
   05032 Morphine addiction
    110220182 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110220182 (PRKCG)
   05161 Hepatitis B
    110220182 (PRKCG)
   05171 Coronavirus disease - COVID-19
    110220182 (PRKCG)
   05163 Human cytomegalovirus infection
    110220182 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110220182 (PRKCG)
   05143 African trypanosomiasis
    110220182 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110220182 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110220182 (PRKCG)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     110220182 (PRKCG)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   110220182 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C APH Kinase-like
Other DBs
NCBI-GeneID: 110220182
NCBI-ProteinID: XP_020859777
UniProt: A0A6P5LN69
LinkDB
Position
Unknown
AA seq 701 aa
MAGLGPGGGEAEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCACCEMNVHRRCVRSVPSLCGVDHTERRGRLQLRIRAPAGDEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPKNVSKQKTRTVKATLNPVWDETFVFTLKPGDVERRL
SIEVWDWDRTSRNDFMGAMSFGVSELLKASVDGWYKLLNQEEGEYYNVPVADADNCGLLH
KFEACNYPLELYERVRLGPSPSPSPSPSPTDSKRCFFGSGSGSGRLHISDFTFLMVLGKG
SFGKVMLAERRGSDELFAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGLGGRPHFLTQL
HSTFQTTDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDADGHIKITDFGMCKENIFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKALSREAVAVCKGFLTKHPVKRLGS
GPDGEVAIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARELPSPGAGASPVPVL
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggctggactgggccccggaggtggggaggccgagggtggcccccggcccctgttttgc
aggaagggggctctgcgccagaaggtcgtgcatgaggtgaagagccacaagttcacagcc
cgctttttcaagcagcccaccttttgtagccactgcacggacttcatctgggggatcggc
aaacagggccttcagtgtcaagtctgcagcttcgtggttcaccgacgatgccacgaattt
gtgaccttcgagtgtccgggcgcggggaaggggccccagacagacgacccccgcaacaag
cacaagtttcgtttgcacagctacagcagcccgaccttctgcgatcactgtggttccctg
ctgtatgggctggtacatcagggcatgaagtgcgcttgctgcgagatgaacgtgcaccgg
cgctgtgtgagaagcgtgccctctctgtgcggtgtggaccacacagagcgacgagggcgt
ctacagttgcgcattcgagccccggcaggggatgagatccacgtgacagtgggcgaggct
cgcaacctcatccccatggaccccaatggcctgtctgatccttacgtgaaactaaagctg
attccggatccgaagaatgtgagcaaacagaagacccggactgtgaaggccacgctaaac
ccagtgtgggacgagacctttgtgttcaccctgaaaccgggggatgtggagagacgcctg
agcatcgaggtctgggattgggaccggacgtcccgcaatgacttcatgggcgccatgtcc
tttggcgtgtcagagctactcaaggcctctgtggacggctggtacaagttactgaaccaa
gaggagggtgaatattacaatgttccagtggctgatgctgacaactgtgggctcctgcac
aaattcgaggcctgtaactatcccctggagctgtatgagcgggtgcgcctgggcccttct
ccctccccttctccctcccccagccccacggattccaagcgatgcttcttcggctctggc
tctggctctggccgtctgcacatctccgacttcaccttcctcatggtgcttggaaagggc
agttttggcaaggtaatgttggcagagcgtcggggctccgatgagctgttcgccattaag
atcctgaagaaggacgtgatcgtgcaggacgacgacgtggactgcacgctggtggagaag
cgcgtgctggccttggggggccgcgggctgggcggacggccgcacttcctcacgcagctc
cattccacttttcagaccaccgaccgactgtactttgtgatggagtacgtgacgggcggg
gacctcatgtaccacattcagcagctgggcaaattcaaggaaccgcacgccgcgttctac
gcggccgaaattgcaatcggcctcttcttccttcacaaccagggcatcatctacagggac
ctgaagctggacaacgtgatgctggacgcggacggacacatcaagatcacggacttcgga
atgtgcaaggagaacatctttcctgggaccacgacccggaccttctgcggaaccccggac
tacatcgctcctgagattatcgcttaccagccctatgggaagtcggtggattggtggtcc
ttcggagtgctgctctatgagatgctggcgggccagcctccgtttgacggggaggacgag
gaggagctgtttcaggccatcatggagcagactgtcacctacccgaaggcgctgtcgcgg
gaggcggtagcagtgtgcaaggggttcctcactaaacacccagtgaagcgtctgggctct
gggcccgatggagaggtggccattcgggctcatggattcttccgctggattgactgggag
cgcctggagagactcgagatccctcctcccttcaggccacgaccatgtggccgcagtggt
gagaatttcgacaaattcttcactcgtgcagccccagcgctgaccccccctgaccgccta
gtcctggccagcatcgaccaggctgatttccagggcttcacctatgtcaatcctgacttt
gtgcatcctgatgctcgagagctccccagtcctggggctggtgccagccctgtgcctgtc
ctgtga

DBGET integrated database retrieval system