KEGG   Phascolarctos cinereus (koala): 110214751
Entry
110214751         CDS       T05867                                 

Gene name
BCL2
Definition
(RefSeq) LOW QUALITY PROTEIN: apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04064  NF-kappa B signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04115  p53 signaling pathway
pcw04140  Autophagy - animal
pcw04141  Protein processing in endoplasmic reticulum
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw04217  Necroptosis
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04340  Hedgehog signaling pathway
pcw04510  Focal adhesion
pcw04621  NOD-like receptor signaling pathway
pcw04630  JAK-STAT signaling pathway
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04915  Estrogen signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw05014  Amyotrophic lateral sclerosis
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05161  Hepatitis B
pcw05162  Measles
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05215  Prostate cancer
pcw05222  Small cell lung cancer
pcw05226  Gastric cancer
pcw05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110214751 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110214751 (BCL2)
   04630 JAK-STAT signaling pathway
    110214751 (BCL2)
   04064 NF-kappa B signaling pathway
    110214751 (BCL2)
   04066 HIF-1 signaling pathway
    110214751 (BCL2)
   04071 Sphingolipid signaling pathway
    110214751 (BCL2)
   04151 PI3K-Akt signaling pathway
    110214751 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110214751 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    110214751 (BCL2)
   04215 Apoptosis - multiple species
    110214751 (BCL2)
   04217 Necroptosis
    110214751 (BCL2)
   04115 p53 signaling pathway
    110214751 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110214751 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110214751 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110214751 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    110214751 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110214751 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    110214751 (BCL2)
   04722 Neurotrophin signaling pathway
    110214751 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110214751 (BCL2)
   05206 MicroRNAs in cancer
    110214751 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110214751 (BCL2)
   05226 Gastric cancer
    110214751 (BCL2)
   05215 Prostate cancer
    110214751 (BCL2)
   05222 Small cell lung cancer
    110214751 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110214751 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    110214751 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110214751 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110214751 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110214751 (BCL2)
   05152 Tuberculosis
    110214751 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110214751 (BCL2)
   05161 Hepatitis B
    110214751 (BCL2)
   05162 Measles
    110214751 (BCL2)
   05168 Herpes simplex virus 1 infection
    110214751 (BCL2)
   05169 Epstein-Barr virus infection
    110214751 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110214751 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110214751 (BCL2)
   01524 Platinum drug resistance
    110214751 (BCL2)
   01522 Endocrine resistance
    110214751 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcw01009]
    110214751 (BCL2)
Protein phosphatases and associated proteins [BR:pcw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110214751 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 110214751
NCBI-ProteinID: XP_020851452
UniProt: A0A6P5L173
LinkDB
Position
Unknown
AA seq 255 aa
MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGDLRAPASPSLPPVVASAPAVGIFSNQP
RHTPLPAEPQDLATSTTAAARNSPLPPPPAVAAATVAAGPAVSPVPPVVHLTLRQAGDDF
SRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNR
EMSPLVDSIALWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWLSLKTLLSLA
LVGACITLGAYLGHK
NT seq 768 nt   +upstreamnt  +downstreamnt
atggctcaccctggaagaagagggtacgataatcgggagatagtgatgaaatacattcat
tataagttgtcacagagagggtacgagtgggatgctggagatctgagggcaccagcctct
ccaagtcttcctcctgttgttgcttctgcccctgctgttgggatcttctctaaccagcca
agacatacacctctgcctgctgaaccccaggacttggccacttctacgactgctgctgct
agaaactcacctttgcctcctcctcctgccgttgctgctgctactgttgccgctggacct
gctgtcagtccagtgccacctgtggtccacctgacccttcgtcaagctggagatgatttc
tcacgaaggtaccggagagactttgatgaaatgtcaggtcagctgcacctgacccctgtt
actgctaggggacgctttgccacagtagtggaggagctgttcagggatggggtgaactgg
gggcggatcgtggccttctttgaatttggtggtgttatgtgtgtggagagcgtcaaccgg
gagatgtcgcccctggtggacagcattgccctgtggatgactgagtacctgaaccggcac
ctgcacaactggatccaagataatggaggatgggatgcctttgtggaattgtatggcaac
agcatgaggcctttgtttgatttctcctggctgtctctgaagactctgctcagcctggct
ctggtgggagcttgcatcactcttggtgcctacctgggacacaaatga

DBGET integrated database retrieval system