KEGG   Phascolarctos cinereus (koala): 110214887Help
Entry
110214887         CDS       T05867                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04146  Peroxisome
pcw04213  Longevity regulating pathway - multiple species
pcw05014  Amyotrophic lateral sclerosis (ALS)
pcw05016  Huntington disease
pcw05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110214887 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110214887 (SOD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    110214887 (SOD1)
   05016 Huntington disease
    110214887 (SOD1)
   05020 Prion diseases
    110214887 (SOD1)
Enzymes [BR:pcw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110214887 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 110214887
NCBI-ProteinID: XP_020851652
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MLKAVCVLKGDGPVQGTIYFEQKQAGEPVEIKGSITGLAEGNHGFHVHEFGDNTQGCTSA
GAHFNPHSKKHGGPNDDERHVGDLGNVTADKDGVAKVSIKDHLIQLSGPMSIIGRTMVVH
EKADDLGKGGNSESEKTGNAGPRLACGIIGIAK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggcggtgtgcgttctgaagggcgacggccccgtgcaaggcacgatctacttc
gagcagaagcaggctggggagcctgtggaaatcaagggaagcattacaggattagctgag
ggaaatcatggattccacgtccatgaatttggcgataacactcaaggatgtacaagtgca
ggtgctcactttaatcctcattccaaaaaacatggtggaccaaatgatgatgaaaggcat
gttggagaccttggcaatgtgactgctgacaaagatggtgtggcaaaagtgtctatcaaa
gatcatctaattcaactttcaggaccaatgtctatcattggccgtactatggtggtccac
gagaaagctgatgacttgggcaaagggggaaattcagagagtgaaaagacgggaaatgct
ggacctcgcctagcttgtggcataattgggattgctaagtaa

DBGET integrated database retrieval system