KEGG   Phascolarctos cinereus (koala): 110215729
Entry
110215729         CDS       T05867                                 

Gene name
ERBB2
Definition
(RefSeq) LOW QUALITY PROTEIN: receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04020  Calcium signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04520  Adherens junction
pcw04530  Tight junction
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05215  Prostate cancer
pcw05219  Bladder cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110215729 (ERBB2)
   04012 ErbB signaling pathway
    110215729 (ERBB2)
   04066 HIF-1 signaling pathway
    110215729 (ERBB2)
   04020 Calcium signaling pathway
    110215729 (ERBB2)
   04151 PI3K-Akt signaling pathway
    110215729 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110215729 (ERBB2)
   04520 Adherens junction
    110215729 (ERBB2)
   04530 Tight junction
    110215729 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110215729 (ERBB2)
   05206 MicroRNAs in cancer
    110215729 (ERBB2)
   05205 Proteoglycans in cancer
    110215729 (ERBB2)
   05230 Central carbon metabolism in cancer
    110215729 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110215729 (ERBB2)
   05226 Gastric cancer
    110215729 (ERBB2)
   05219 Bladder cancer
    110215729 (ERBB2)
   05215 Prostate cancer
    110215729 (ERBB2)
   05213 Endometrial cancer
    110215729 (ERBB2)
   05224 Breast cancer
    110215729 (ERBB2)
   05223 Non-small cell lung cancer
    110215729 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110215729 (ERBB2)
   01524 Platinum drug resistance
    110215729 (ERBB2)
   01522 Endocrine resistance
    110215729 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110215729 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110215729 (ERBB2)
   04090 CD molecules [BR:pcw04090]
    110215729 (ERBB2)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110215729 (ERBB2)
Protein kinases [BR:pcw01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   110215729 (ERBB2)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   110215729 (ERBB2)
CD molecules [BR:pcw04090]
 Proteins
  110215729 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH
Other DBs
NCBI-GeneID: 110215729
NCBI-ProteinID: XP_020853103
UniProt: A0A6P5L4U3
LinkDB
Position
Unknown
AA seq 1255 aa
MDLSGCCCWGLLLVLLPPAVWGTQVCTGTDMKLQYPASIENHLDTLSHLYQGCQVVQGNL
ELTYLPADASLSFLQDIQEVQGYVLIAHSLVKSFPLQRLRIIRGTQLFEDKYALVVLDNG
IPLGTAPPTPEGPPGLRELQLRSLTEILKGGVLIQKNPQLCHQDTVLWTDIFHKNNHLAI
TAIDTNHSRTCSPCSSSCKSGQCWGEGHDNCQSLTSTICASGCARCKGPLPTDCCHEQCA
AGCTGPKHSDCLACLHFNHSGICEQHCPPLVIYNSDTFESMPNPDGRYTFGSSCVKSCPY
NYLATDVGSTSCTLVCPLHSQEVTAEDGTHRCEKCSKACPKVCYGLGMGHLRSVRAVNST
NIQDFAGCRKIFGSLAFLPETFAGDLATNTSPLMPEDLKVFENLEEITGYLYISAWPDSL
PDLSIFQNLRVIRGRVLHNGVYSLTLEHLSIGWLGLRSLRELGSGLALIHHNAHLCFVHT
VPWDQLFRNPRQALLYSANRPAHECAREGLACYSLCAQGHCWGPGPTQCLNCSQFLRGQE
CVEECRVMQGYPREYVKERRCFPCHEECQPQNSTETCFGSEADKCAACAHFKDPPACVAR
CPSGVKSDLSFIPIWKYPDDEGICQTCPTNCTHSCTVLDDKGCPAEQKLSPVTSIIAGVV
GVLLALIIGLIIGILIKRRKQKERKHTMRRLLQETELVEPLTPSGALPNQAQMRILKETE
LRKVKVLGSGAFGTVYKGIWIPDGESVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGS
PYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLCSQDLLNWCVQIAKGMNYLEEV
RLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILCRRF
THQSDVWSYGVTVWELMTFGAKPYEGIPAREIPDLLEKGDRLPQPPVCTIDVYMIMVKCW
MIDSECRPRFRELVTEFSRMARDPQRFVVIQNEDSGPASPLDSTFYRSLLEEDDMGDLVD
AEEYLVPQQGFFCPDPPLAPGPGGTAHRRHRSSSTRSGGEPPGGLEGSEDDAPQSSAEPW
EGTGSDVFDGDPGGSPKGLQGLPPRDLSPLQRYTEDPTGTLPPEMDGYIVPPACGPLPEY
VNQPEVHLPPPSPLEGTLTPPHPSSSTLERPKLPPPGKNGVVKDTFTFGAAVENPEYLAP
HGRGPLHLSPTAFSPAFDNLYYWDQDPPDRGAAPNGFAGTPTAENPEYLGLDMTV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggacctgtcgggctgctgctgttgggggctccttctggtcctcctgcccccagcagtc
tggggaacccaagtgtgcacaggcacagacatgaagctgcagtatcctgccagtattgag
aatcaccttgacacactgagccacctgtaccaaggatgccaggttgtacaaggcaacctg
gagctcacttacctgcctgctgatgccagcctctccttcctccaggacatccaagaagtg
caggggtatgtgctgattgcccacagcctagtgaagagtttcccactgcagaggctacgc
atcatacgaggcacacagctctttgaggacaaatatgccctggttgttctggacaatggg
attccccttgggactgcccctcccacaccagagggcccccctggccttcgagagctgcaa
cttcgaagtctcacagagattctgaaaggtggggtcctgatccagaagaaccctcagcta
tgtcaccaggacacagtgctgtggactgacatcttccataagaacaaccacttggctatc
actgccatcgacacaaaccacagtcgaacttgcagcccctgttcttcatcatgtaaatct
ggccagtgctggggggaaggacatgacaactgtcagagcttgaccagcacaatctgtgcc
agtggctgtgcccgctgcaaggggcccctccccaccgactgctgccacgagcagtgtgct
gctggctgcactggccccaagcattctgactgcctggcctgcctccacttcaaccacagt
ggcatctgtgagcagcactgcccaccgctggtcatctacaactcagacacctttgaatca
atgcctaatcctgatgggcgatacacctttgggtccagttgtgtgaaatcatgtccctat
aactacctggctacagatgtgggctccacatcttgcacccttgtgtgtcccctgcacagc
caagaggtgactgccgaggatgggacccatcggtgtgagaagtgcagcaaggcctgcccc
aaagtgtgttacgggctgggcatggggcacctgcggtcagtgagagctgtcaacagcacc
aacatccaggactttgccggctgcaggaagatctttggaagcctggccttcctgcctgag
accttcgcaggagacttggccaccaatacttctccactaatgcctgaagacctcaaggtc
tttgagaacctggaggagatcacaggctacctgtacatctcagcctggcctgacagcctc
cctgacctcagcatctttcagaacctaagggtgatcaggggaagggtgttgcacaatggt
gtctactccctgactctggagcatctgagtattggctggctggggctgcggtcactgaga
gagctgggcagtgggttagcactcatccatcacaatgcccacctatgttttgttcacacg
gtgccttgggaccagctcttccgcaacccccgtcaggccctgctctacagtgccaaccga
cctgcccatgagtgtgccagggagggactagcatgctactccctgtgtgctcaggggcat
tgctggggccctggaccaactcagtgtctcaactgcagccaatttctccgagggcaggag
tgtgtggaggagtgccgagtcatgcagggttacccccgagaatatgtgaaggagaggcgt
tgcttcccgtgccatgaggagtgccagccacagaacagcactgagacctgctttggatca
gaagctgacaaatgtgcagcctgtgcacacttcaaggacccacctgcctgtgtggcccga
tgccccagtggtgtgaagtccgacctctctttcatacctatctggaagtacccagatgat
gagggcatttgccagacctgccccaccaactgcacccactcctgtactgtactggatgac
aaaggctgtcctgctgagcagaaactcagccctgtgacctccatcattgctggggtggtt
ggagtgctcctagccctcatcataggcctgatcatcggcatcttgattaagcgtcgaaaa
cagaaggaacggaaacacaccatgagaaggctgctacaggagaccgagctggtggagccc
ctgacacctagtggagcattgcccaaccaagctcagatgcgtatcctaaaagagaccgag
ctgagaaaagtgaaggttctcggttctggggctttcggcacagtctacaagggtatttgg
atccctgatggtgaaagtgtgaagatcccagtggctatcaaggtgttgagggaaaacaca
tcccccaaagccaacaaggagatcttggatgaagcatacgtgatggctggtgttggctct
ccatatgtgtctcgccttctgggcatctgcttgacatccacggtgcagctggtgacccag
cttatgccctacggctgcctcttggaccatgtgcgtgaaaaccgagggcggctttgctcc
caggacctcctcaactggtgtgtgcagattgccaaggggatgaactacctggaggaggtt
cggctagtacatagagacctggccgccagaaatgtgctggtcaaaagtcccaaccacgtc
aagatcaccgactttggactcgcgaggctcttggacattgacgagacagagtaccacgcc
gatgggggcaaggtccccatcaagtggatggcactggagtccattctctgccgaagattc
acccatcagagtgatgtgtggagctatggggtgacagtgtgggaattgatgaccttcggg
gccaaaccatatgaggggattcctgcccgagagattcctgacttgctggagaagggggac
cgactgccacagccccctgtctgcaccattgatgtctacatgatcatggtcaaatgttgg
atgattgactctgagtgtcggcctcggtttcgggagctagttactgaattctcacgaatg
gcccgagaccctcagcgctttgtggtcatccagaatgaggattctggcccagccagcccc
ctggacagcactttctaccgctcactgttggaagaagatgacatgggcgatttggtggat
gcagaagagtacctggtgccccagcaaggcttcttctgccctgaccctcccctggctcca
ggtcctgggggtactgcccaccgaagacacagaagttcttctacaaggagtggtggggag
cctccaggaggactagaaggctcagaagatgatgctccccaatcttcagcagagccttgg
gaagggactggttcagatgtgtttgatggggaccctggagggagccctaaggggctacag
ggactcccccctcgagacctcagccccctgcagcgctacactgaggatcccacaggaaca
ctgccccctgagatggatggctacatcgtcccacctgcctgtggccccctgccagaatac
gtgaaccagccagaggtgcatctaccacccccttcacccctggaggggaccctgactccc
cctcacccatccagctccaccctggaacgccccaagttgcctcctccagggaagaatgga
gtggtaaaagacacatttacctttggtgcagctgtggagaaccccgagtacttggccccc
cacggacggggtccccttcatctttccccgactgccttcagcccagcctttgacaacctt
tactactgggaccaggatcctcctgatcgaggggctgcccctaatggctttgcagggacc
cccacagctgagaaccctgagtacttgggtttggatatgactgtgtga

DBGET integrated database retrieval system