KEGG   Phascolarctos cinereus (koala): 110215785
Entry
110215785         CDS       T05867                                 

Gene name
DCAKD
Definition
(RefSeq) dephospho-CoA kinase domain-containing protein
Organism
pcw  Phascolarctos cinereus (koala)
SSDB
Motif
Pfam: CoaE AAA_18 AAA_33 AAA_31 HicA_toxin
Other DBs
NCBI-GeneID: 110215785
NCBI-ProteinID: XP_020853234
UniProt: A0A6P5L4H3
LinkDB
Position
Unknown
AA seq 226 aa
MFLVGLSGGIASGKSSVVQVFRDLGCAVIDADAIAHQVVKPGYPAYHRIVQAFGREILLE
NGEINRQALGSIIFRHSEKRKLLNAITHPDIRKEMLKQILKYLVQGYRYVILDIPLLFET
KTMLRFMKHTVVVYCDPQTQLSRLMQRNGLSREEAEERIAAQLPLEEKRQLAQHILDNSG
EWEATRRQTLHLHSQLEDSLDFLPLRLGLFAGFVGIIYLLSQHLLL
NT seq 681 nt   +upstreamnt  +downstreamnt
atgttcctggtgggcctgtcagggggcattgcctcaggaaagagctcagtagttcaggtg
ttcagggatctgggctgtgctgtgatcgatgcagatgccattgcccaccaggtggtaaaa
ccaggctaccctgcctaccatcgtattgtgcaagcctttggacgtgagatcctgctagag
aatggtgagatcaaccgccaggctttgggaagcatcatcttccgccattctgagaagcgg
aaactgctgaatgccatcacccatccagacattcgtaaggagatgctgaagcagatcctg
aagtacttggttcaggggtaccgatatgtgatcttggacattcccttgctgtttgaaact
aaaacaatgttacgcttcatgaagcacacagtggtggtatattgtgacccccagacccag
ctgtcacggctgatgcagcggaatgggctgagtcgagaggaggctgaggaacggattgca
gcccaactgcctctggaagagaagcgccaactggctcagcacatcctggacaactcaggg
gagtgggaggccactcgccgtcagaccctccacctgcattcccagctagaggattctctg
gactttttaccattgaggcttggcctgtttgctggttttgttggcatcatatacctgttg
tctcagcacctcctgctttaa

DBGET integrated database retrieval system