KEGG   Phascolarctos cinereus (koala): 110216083
Entry
110216083         CDS       T05867                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04110  Cell cycle
pcw04151  PI3K-Akt signaling pathway
pcw04218  Cellular senescence
pcw04310  Wnt signaling pathway
pcw04350  TGF-beta signaling pathway
pcw04390  Hippo signaling pathway
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04630  JAK-STAT signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw05132  Salmonella infection
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05213  Endometrial cancer
pcw05216  Thyroid cancer
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05222  Small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110216083 (MYC)
   04012 ErbB signaling pathway
    110216083 (MYC)
   04310 Wnt signaling pathway
    110216083 (MYC)
   04350 TGF-beta signaling pathway
    110216083 (MYC)
   04390 Hippo signaling pathway
    110216083 (MYC)
   04630 JAK-STAT signaling pathway
    110216083 (MYC)
   04151 PI3K-Akt signaling pathway
    110216083 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110216083 (MYC)
   04218 Cellular senescence
    110216083 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110216083 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110216083 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110216083 (MYC)
   05202 Transcriptional misregulation in cancer
    110216083 (MYC)
   05206 MicroRNAs in cancer
    110216083 (MYC)
   05205 Proteoglycans in cancer
    110216083 (MYC)
   05230 Central carbon metabolism in cancer
    110216083 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110216083 (MYC)
   05225 Hepatocellular carcinoma
    110216083 (MYC)
   05226 Gastric cancer
    110216083 (MYC)
   05216 Thyroid cancer
    110216083 (MYC)
   05221 Acute myeloid leukemia
    110216083 (MYC)
   05220 Chronic myeloid leukemia
    110216083 (MYC)
   05219 Bladder cancer
    110216083 (MYC)
   05213 Endometrial cancer
    110216083 (MYC)
   05224 Breast cancer
    110216083 (MYC)
   05222 Small cell lung cancer
    110216083 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110216083 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110216083 (MYC)
   05161 Hepatitis B
    110216083 (MYC)
   05160 Hepatitis C
    110216083 (MYC)
   05163 Human cytomegalovirus infection
    110216083 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110216083 (MYC)
   05169 Epstein-Barr virus infection
    110216083 (MYC)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    110216083 (MYC)
Messenger RNA biogenesis [BR:pcw03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     110216083 (MYC)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 110216083
NCBI-ProteinID: XP_020853572
UniProt: A0A6P5L6T2
LinkDB
Position
Unknown
AA seq 445 aa
MPLSASSPSKTYDYDYDSVQPYFYFEEEENFYQQQQHSELQPPAPSEDIWKKFELLPTPP
LSPSRRSSLSSSSSSAGGGGGGGGGGGSVPSTADQLEMVTELLGGDMVNQSFICDPDDES
FVKSIIIHDCMWSGFSAAAKLVSEKLASYQATRKDSSWAPRHSAPPTHSLYLQDMHTAAS
ECIDPSVVFPYPLSESSSPKRCASPVSSSSFSSSSTSSSMMSSVASSPRSSPEPLALCED
TPPTTSSSSSSSSSSSDSEEEQEDEEEIDVVTVEKRQPSTRRSESGSHTAGGHSKPPHSP
LVLKRCHVPTHQHNYAAPPSTKKDYPSAKRIKLDSGRILKQISNNRKCASPRSSDTEEND
KRRTHNVLERQRRNELKLSFFALRDQIPELENNEKAPKVVILKKATAYIISIQAEEQKLS
TESELLRKEQLQLKLKLERLQNSCA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcccctcagtgccagctcccctagcaaaacctacgactacgattatgattcggtgcag
ccctatttctacttcgaggaagaggaaaacttctaccagcagcagcagcacagcgagctg
cagccaccggctcctagcgaggatatctggaagaagttcgagctgctgcccacgcctccc
ctgtctccgagccggcgctccagcctctcctcctcgtcctcatccgccggcggcgggggt
gggggcggaggaggaggcggctccgtgccctccactgcggaccagctggagatggtgact
gagctgctcgggggtgacatggtcaaccagagtttcatctgcgacccggacgacgagtcc
ttcgtcaagtccatcatcattcatgactgcatgtggagcggcttctcggctgcggccaag
ctggtttctgaaaagcttgcctcctaccaggcgactcgaaaagacagctcttgggccccc
cggcacagcgcgcccccaacgcacagcctctacttgcaagacatgcacaccgcggcctct
gagtgcattgacccctccgtggtcttcccctacccactcagtgaaagtagctcgcccaag
cgatgtgcctccccggtttcctcttcctccttctcctcgtcctccacctcttcctccatg
atgtcctcggtggcctcctccccccggtccagcccagagcccctggcactctgtgaggac
acgccacccaccacaagcagcagcagtagcagcagcagcagcagcagcgactctgaagaa
gaacaagaagatgaggaagagattgatgttgttacagtggagaagaggcagccatctacg
agaagatcagaatcaggctcccacacagctggaggccacagtaaacctccccacagcccc
ctagtcttgaagaggtgtcacgtccccacacatcagcacaactatgctgcacccccctcc
acaaagaaagactatccctctgctaagaggattaagttggacagtggcagaattctcaaa
caaattagcaacaaccgaaaatgtgccagccccaggtcttcagatacggaggagaacgac
aagaggaggacgcacaatgtcttagagcgccagcggagaaacgaactgaagctaagcttc
ttcgccttgcgagaccagatccccgagttagagaacaatgagaaggcacccaaagttgtc
atcctcaaaaaggccacagcttatatcatatctatccaggcagaggagcaaaaattgtcc
acagagagtgagctgttgaggaaagaacagcttcagttgaaactcaaacttgaacggctg
cagaactcttgtgcataa

DBGET integrated database retrieval system