KEGG   Phascolarctos cinereus (koala): 110216585
Entry
110216585         CDS       T05867                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw03460  Fanconi anemia pathway
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05216  Thyroid cancer
pcw05217  Basal cell carcinoma
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    110216585 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110216585 (POLK)
   05202 Transcriptional misregulation in cancer
    110216585 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110216585 (POLK)
   05212 Pancreatic cancer
    110216585 (POLK)
   05225 Hepatocellular carcinoma
    110216585 (POLK)
   05226 Gastric cancer
    110216585 (POLK)
   05214 Glioma
    110216585 (POLK)
   05216 Thyroid cancer
    110216585 (POLK)
   05220 Chronic myeloid leukemia
    110216585 (POLK)
   05217 Basal cell carcinoma
    110216585 (POLK)
   05218 Melanoma
    110216585 (POLK)
   05213 Endometrial cancer
    110216585 (POLK)
   05224 Breast cancer
    110216585 (POLK)
   05222 Small cell lung cancer
    110216585 (POLK)
   05223 Non-small cell lung cancer
    110216585 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110216585 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcw03400]
    110216585 (POLK)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     110216585 (POLK)
DNA repair and recombination proteins [BR:pcw03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    110216585 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone Cdd1
Other DBs
NCBI-GeneID: 110216585
NCBI-ProteinID: XP_020854091
UniProt: A0A6P5LEY0
LinkDB
Position
Unknown
AA seq 864 aa
MDSTKENNNDKDGLLLRMGLNDNKAGMDGLDKEKINKIIMEATKGSRFYENELKKEKQVN
QRIENMMQQKSQITTQRLWKAQLQVDKLAMELEQSRNLHCTIIHIDMDAFYAAVEMRDNP
ELRDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLTIVSPNFDKYREVSKEV
MEILADYDPNFMAVSLDEAYLNITKYLEERQNWPEDKRRYFVNRGNTTENEKSEAVISKA
PGLNEAAVSISPLLFEDSPPQLQQQEPEIPSQAHFEEQRDPQVLQNSVIFGTSAEEVVKE
IRFRIEQKTSLTASAGIAPNTMLAKVCSDKNKPNGQYQIPPNREAVMDFIKDLPIRKVPG
IGKVTEKMLKALGIITCSDLYQKRALLSLLFSETSWHSFLHISLGLGSTQMERDGERKSM
SIERTFSEISKAEELYSLCQELCSDLAQDLQKEGLKGKTVTIKLKNVNFEVKTRASTVAA
VVSTAEEIFAIAKELLKVEIDADYPRPLRLRLMGVRISGFSNEEDRKHGQRSIISFLKAG
SHVLDPVGSVVDKNDQDQVMKPPETSHKESFFTKKRSEMSWNHQDNFKCEPETKQSFQVS
QPPSLSKEEMKENLETENTDDCQVITCPICFKEQGRICLEALNRHVDECLSRTLVDCDPK
TVAVPQSQSFCSEVNLDLKTHKTTDSLLIDFVPSVSVDVFSKGKSMEDLNTRAGDEQSPK
QYSSLWSKSSLDEYFYQNSSQENEGYDAKSSGGQTTLQTSFPRDETLVCPVCNLQQKTSD
LMLFNSHVDICLNKGLIQELKKDKVNPVMNCPAENSKSTGSSGKIQKTVNVTAKTKRPGL
MTQNSTSKKIKPNNSKYTIDSFFK
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggacagtacaaaagagaataacaatgacaaagatggacttctgcttagaatgggactt
aatgacaacaaagcaggaatggatggattagataaagagaaaataaataaaattattatg
gaagccaccaagggatctagattttatgaaaatgagctcaaaaaggaaaagcaagtaaac
caacgaattgaaaatatgatgcaacaaaaatctcaaattaccacccagcggctgtggaaa
gcacaattacaggttgacaagcttgcaatggagttggaacagagccgtaatctgcactgt
actataatacacattgacatggatgctttttatgcagctgtagaaatgagagataatcca
gagctgagagataaacccattgcagtaggttcaatgagtatgttgtccacttcaaattat
catgcgagaaggtttggagtacgggcggctatgcctggatttattgctaagagactctgc
ccacaattaactatagtgtctccaaattttgacaaatatcgagaagtgagtaaggaggtt
atggaaattcttgctgattatgatccaaattttatggctgtgagccttgatgaagcctat
ttgaatataacaaagtatttagaggaaagacaaaactggcctgaggataaaagaagatat
ttcgtcaacagaggaaacactacagaaaatgaaaaatcagaagctgtcatatcaaaggct
ccagggttaaatgaagctgctgtatccatctcccctttactctttgaagatagccctcct
caactacagcagcaggagccagaaattccttcccaagcgcactttgaagaacagagagat
cctcaagtcctccaaaattcagttatttttggaacttcagctgaggaagtcgtaaaggaa
attaggttcagaatcgaacaaaaaacatcgttgacagccagcgcaggcattgctccaaat
acaatgttggcgaaagtatgcagtgataaaaataaaccaaatggacaataccaaattccc
cctaacagagaagctgtgatggacttcatcaaggatttacccattagaaaggttccagga
atagggaaagtaacagagaaaatgttaaaagcacttggaattatcacctgctcagacctt
taccagaaaagggccctactttctcttcttttttctgaaacatcttggcatagcttcctt
catatttcccttggtctgggttcaacacaaatggaacgggatggagagaggaaaagtatg
agcattgaaagaacattcagtgagataagtaaagcagaggaactgtatagcttgtgccaa
gaactttgtagtgatcttgctcaggatctacagaaagaaggacttaagggcaaaacagtt
acaattaagctgaagaatgtgaattttgaagtaaaaactcgagcgtctaccgtagcagct
gttgtttctactgcagaagaaatatttgctattgctaaggaacttctaaaagtagaaatt
gatgctgattacccacggcccttacgactaaggcttatgggtgtacggatatcaggcttt
tccaatgaagaagacaggaaacatggacaaagaagcatcattagcttcttaaaagctgga
agccatgtcctagatcctgttgggtctgtggtggataaaaatgaccaagatcaagtcatg
aaacctccagaaacatctcacaaggagagtttcttcactaaaaagcggtcagaaatgagt
tggaaccaccaagacaactttaaatgtgagcctgagactaaacaaagcttccaagtttca
cagccacctagtctttcaaaggaagaaatgaaagagaatttagagacagaaaatacagat
gactgtcaggtcattacctgtcctatttgttttaaggaacaaggaagaatctgtttggaa
gcacttaacaggcatgtggatgaatgcctcagtaggacactggtggactgtgaccccaaa
acggtggctgtcccacaatcacagtctttttgttcagaagtaaatctggatttaaaaacc
cataaaactacagatagtctgttaatagattttgtgccttcagtaagtgtagatgtgttt
tctaagggaaaaagtatggaggatttaaacacaagggcaggggatgagcaaagcccaaaa
cagtattctagcctctggagcaaatcttctcttgatgaatatttttatcaaaattcttcc
caagaaaatgaaggatatgatgccaagtcttcaggtgggcaaacaaccctccagacatct
tttccaagagatgaaacattggtgtgtcctgtttgcaacttacagcaaaagacttctgat
ctgatgctcttcaatagtcatgtagacatttgcttaaataaaggtcttatccaggagcta
aagaaggacaaagttaatccagttatgaattgtccagcagaaaattctaaaagtactggg
agttctggcaaaatacagaagactgtgaatgttacagcaaaaacaaaaaggccgggactg
atgacccagaattcaacatcaaagaaaatcaaaccaaacaattccaaatacaccattgat
agcttttttaaatga

DBGET integrated database retrieval system