KEGG   Phascolarctos cinereus (koala): 110217123
Entry
110217123         CDS       T05867                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04014  Ras signaling pathway
pcw04390  Hippo signaling pathway
pcw04392  Hippo signaling pathway - multiple species
pcw05200  Pathways in cancer
pcw05206  MicroRNAs in cancer
pcw05219  Bladder cancer
pcw05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110217123 (RASSF1)
   04390 Hippo signaling pathway
    110217123 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    110217123 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110217123 (RASSF1)
   05206 MicroRNAs in cancer
    110217123 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    110217123 (RASSF1)
   05223 Non-small cell lung cancer
    110217123 (RASSF1)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 110217123
NCBI-ProteinID: XP_020854954
LinkDB
Position
Unknown
AA seq 367 aa
MSAEPELIELRNLVRSPDGLRGQEIGRSSGPRSPGRLERANALRIAPGRGPDVLLRGRQV
RLLGGHSDPRLTAGPGRGHCFRPSGPGTHTWCDLCGDFIWGVIRKGLQCVHCKFTCHYRC
RALIRLDCCGPRDLSLEPALERDTNVDEPLEWEKPILSQTEIEQKIKEYNSQINSNLFMS
LNKDGSYTGFIKVQLKLVRPVSVPATKKPPSLQDAKRPPGKNQAVKRRTSFYLPKDTVKH
LHVLSRTRAREVIEALLRKFLVVDNPRKFALFERAERHDQVYLRKLSDDEQPLRLRLLAG
PSEKALSFVLKENETGDVNWDAFSMPELHNFLRILQREEEEHVRQILQKYSRCRQKMQEA
LEARPLG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtctgcagagccggagctgatcgagctgcggaacttggtccggtcccccgacggccta
cgggggcaggagattggccggagctcgggccctcggagtccgggccggctggagcgcgcc
aatgcgctgcgcatcgccccgggccgcggcccagacgtgctgctccgcggccgtcaagtc
cgtctgctgggcggccacagcgatccccgactcacggccggaccgggccggggccactgc
ttccgcccgtcagggcctggtacccacacttggtgcgacctctgtggggactttatctgg
ggcgtcattcgcaaaggcctgcaatgtgtccactgcaagtttacttgccattaccgatgc
cgagccctgatccgcttagactgttgtggtccccgtgatttgagcttggaacctgccttg
gaaagagacaccaatgtggatgagccactggagtgggagaaaccaatcctttctcaaact
gagattgagcagaagatcaaggagtataacagccagattaacagtaacctcttcatgagc
ctgaacaaggatggttcctatactggtttcatcaaggtacaattgaaacttgtgcgccca
gtgtctgtgccggctaccaagaagccgccttccctgcaggatgccaagcgaccccctggg
aaaaaccaagcagtgaagcgccgtacctccttttatcttcccaaagacacagtcaaacac
ctgcatgtgttgtcacggacccgagcccgagaggtcattgaggcgctgctccgaaaattc
ctagtggtggataacccccgaaaatttgccctgtttgagcgggcagagcgccatgatcaa
gtgtacctgcggaagctgtcagatgatgaacaacccttgcgcttacgactgctcgcagga
cctagtgaaaaagccttgagttttgtgctaaaagaaaatgagactggagatgtcaattgg
gatgccttcagcatgcctgaattacataatttcctgcgtatcctgcaacgagaagaagag
gaacacgtgcgacaaatcctacagaagtattctcgttgccgccagaagatgcaggaagcg
ctagaagcccgccccctgggatga

DBGET integrated database retrieval system