KEGG   Phascolarctos cinereus (koala): 110217257
Entry
110217257         CDS       T05867                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04012  ErbB signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04110  Cell cycle
pcw04115  p53 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04218  Cellular senescence
pcw04630  JAK-STAT signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04934  Cushing syndrome
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05169  Epstein-Barr virus infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05216  Thyroid cancer
pcw05217  Basal cell carcinoma
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110217257 (CDKN1A)
   04630 JAK-STAT signaling pathway
    110217257 (CDKN1A)
   04066 HIF-1 signaling pathway
    110217257 (CDKN1A)
   04068 FoxO signaling pathway
    110217257 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    110217257 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110217257 (CDKN1A)
   04115 p53 signaling pathway
    110217257 (CDKN1A)
   04218 Cellular senescence
    110217257 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110217257 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    110217257 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110217257 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    110217257 (CDKN1A)
   05206 MicroRNAs in cancer
    110217257 (CDKN1A)
   05205 Proteoglycans in cancer
    110217257 (CDKN1A)
   05203 Viral carcinogenesis
    110217257 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110217257 (CDKN1A)
   05212 Pancreatic cancer
    110217257 (CDKN1A)
   05225 Hepatocellular carcinoma
    110217257 (CDKN1A)
   05226 Gastric cancer
    110217257 (CDKN1A)
   05214 Glioma
    110217257 (CDKN1A)
   05216 Thyroid cancer
    110217257 (CDKN1A)
   05220 Chronic myeloid leukemia
    110217257 (CDKN1A)
   05217 Basal cell carcinoma
    110217257 (CDKN1A)
   05218 Melanoma
    110217257 (CDKN1A)
   05211 Renal cell carcinoma
    110217257 (CDKN1A)
   05219 Bladder cancer
    110217257 (CDKN1A)
   05215 Prostate cancer
    110217257 (CDKN1A)
   05213 Endometrial cancer
    110217257 (CDKN1A)
   05224 Breast cancer
    110217257 (CDKN1A)
   05222 Small cell lung cancer
    110217257 (CDKN1A)
   05223 Non-small cell lung cancer
    110217257 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110217257 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110217257 (CDKN1A)
   05161 Hepatitis B
    110217257 (CDKN1A)
   05160 Hepatitis C
    110217257 (CDKN1A)
   05163 Human cytomegalovirus infection
    110217257 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110217257 (CDKN1A)
   05169 Epstein-Barr virus infection
    110217257 (CDKN1A)
   05165 Human papillomavirus infection
    110217257 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110217257 (CDKN1A)
   01522 Endocrine resistance
    110217257 (CDKN1A)
SSDB
Motif
Pfam: CDI Arm_vescicular
Other DBs
NCBI-GeneID: 110217257
NCBI-ProteinID: XP_020855211
LinkDB
Position
Unknown
AA seq 201 aa
MAKPGFYFGFLRISVQISYSVLSRFLGRSFSFLRVVTMSESPSRTRQIPCSGKLCRNLFG
PVDHEQLQQDCQDLMQSCTQEAQRRWNFDFVTETPLDGDFAWERVRGLDLPSIYRPSGPW
GREDLGGKRPKPQPSSPALLQMSAQGDHVDLSLSCTVVPLTPEREEGSKAGTSQPTRKHK
QTSMTDFYHSKRRLIFYKRKP
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcaaagcctggattctattttggttttttgagaatttctgtccagatttcctactca
gttctcagccgcttcttgggccggagcttcagttttctgagagtcgtcaccatgtctgag
tcaccgagcagaactcgtcagatcccctgcagtgggaaactttgccggaacctctttgga
cctgtggaccacgagcagttgcagcaagactgccaggatctgatgcagagctgcactcag
gaagcccagcgccgatggaacttcgacttcgtcaccgagactcccctggacggcgacttt
gcctgggagagggtccgaggcctggatctgccctccatatatcgtccatcagggccatgg
ggcagggaggacctgggggggaagaggccaaagccccagcccagctccccagccctgcta
cagatgtccgcccagggagaccatgtggacctgtccctctcctgcaccgtagtaccactg
accccagagcgggaggaagggtccaaggctgggacctcccaaccaacccgaaaacacaag
cagaccagcatgactgatttctaccattcaaagcgaaggctcatcttctacaagagaaag
ccgtga

DBGET integrated database retrieval system