KEGG   Phascolarctos cinereus (koala): 110217311
Entry
110217311         CDS       T05867                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01524  Platinum drug resistance
pcw04141  Protein processing in endoplasmic reticulum
pcw04210  Apoptosis
pcw04215  Apoptosis - multiple species
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05160  Hepatitis C
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05203  Viral carcinogenesis
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05216  Thyroid cancer
pcw05217  Basal cell carcinoma
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110217311 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110217311 (BAK1)
   04215 Apoptosis - multiple species
    110217311 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110217311 (BAK1)
   05202 Transcriptional misregulation in cancer
    110217311 (BAK1)
   05206 MicroRNAs in cancer
    110217311 (BAK1)
   05203 Viral carcinogenesis
    110217311 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110217311 (BAK1)
   05212 Pancreatic cancer
    110217311 (BAK1)
   05225 Hepatocellular carcinoma
    110217311 (BAK1)
   05226 Gastric cancer
    110217311 (BAK1)
   05214 Glioma
    110217311 (BAK1)
   05216 Thyroid cancer
    110217311 (BAK1)
   05220 Chronic myeloid leukemia
    110217311 (BAK1)
   05217 Basal cell carcinoma
    110217311 (BAK1)
   05218 Melanoma
    110217311 (BAK1)
   05213 Endometrial cancer
    110217311 (BAK1)
   05224 Breast cancer
    110217311 (BAK1)
   05222 Small cell lung cancer
    110217311 (BAK1)
   05223 Non-small cell lung cancer
    110217311 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    110217311 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110217311 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110217311 (BAK1)
   05160 Hepatitis C
    110217311 (BAK1)
   05164 Influenza A
    110217311 (BAK1)
   05162 Measles
    110217311 (BAK1)
   05168 Herpes simplex virus 1 infection
    110217311 (BAK1)
   05163 Human cytomegalovirus infection
    110217311 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110217311 (BAK1)
   05169 Epstein-Barr virus infection
    110217311 (BAK1)
   05165 Human papillomavirus infection
    110217311 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110217311 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pcw03029]
    110217311 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcw02000]
    110217311 (BAK1)
Mitochondrial biogenesis [BR:pcw03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    110217311 (BAK1)
Transporters [BR:pcw02000]
 Other transporters
  Pores ion channels [TC:1]
   110217311 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 110217311
NCBI-ProteinID: XP_020855297
UniProt: A0A6P5LBI2
LinkDB
Position
Unknown
AA seq 204 aa
MASRQVSRVRAPSSTAEEQVARQTEDVFRSYVYYRHQQEQEAEGEAAPADPEMDTLPQEL
SSTTQQVGRQLAIIGDDISRRYDSEFKDMLQRLQPTSETAYEYFTMIASSLFESGINWGR
VVALLGFGYRLALHVYQRGLTGFLGRVARFVADFMVQHCIARWIAQNGGWVAALDLSNNS
ILYVMTVLAVVLLARFVIRRFFQP
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcttctaggcaggtgagccgggttcgagccccctcatctactgcagaggagcaagtg
gcccgacagactgaagatgttttccgaagctatgtctactaccgccaccaacaagagcag
gaagctgagggagaagccgctcctgctgacccagagatggacaccctgccccaagagctc
agcagcaccactcaacaggttggccgacagctagccatcattggggatgacatcagccgt
aggtatgactcagaattcaaggacatgctacagcgtttacagcccacctcagaaactgcc
tatgagtacttcaccatgattgcctccagcctgtttgagagtggcatcaactggggccgg
gtggtggcactgctgggctttggctaccggttggcacttcatgtttaccagcggggcctg
actggcttcctgggacgcgtggctcgcttcgtagctgacttcatggtccaacactgcatc
gcccgatggattgcccagaatgggggctgggtggcagccctggacctctctaacaactcc
attttgtacgtgatgacggtcttggccgtggtgctcttggctcgattcgttatccgaaga
ttcttccagccctga

DBGET integrated database retrieval system