KEGG   Phascolarctos cinereus (koala): 110218449Help
Entry
110218449         CDS       T05867                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw05200  Pathways in cancer
pcw05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110218449 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110218449 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110218449 (NKX3-1)
Transcription factors [BR:pcw03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    110218449 (NKX3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN SCHIP-1 Homez
Motif
Other DBs
NCBI-GeneID: 110218449
NCBI-ProteinID: XP_020856843
LinkDB All DBs
Position
Unknown
AA seq 254 aa AA seqDB search
MLSAQEPPRPSRLRGAAAGTPEPPPPRSPRGTALAPAKPLTSFLIQDILWDGPERRSVGR
LSPAPGPEPEPEPALQPEAEPGSLSGSESGPAPQDEQPERPAEPDQSTEPGSSPSGTESD
AHFETCLLDCENPAGAASPKALKPPKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAK
NLKLTETQVKIWFQNRRYKTKRKQLTSDLGDLDKNSLPSLKEENFSGASLISMYNSYPYY
PYLYCWGGWSPAFW
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcgcccaggagccacctcggccctcccggctccggggagcagccgccggaacc
cctgagccgccgccgccacgcagccctcggggcacggccctggcccccgccaagcccctc
acctccttccttatccaggacatcttatgggacggaccagagaggcgcagcgtcgggagg
ctcagccctgctcccgggccggagccagagcctgagcccgcgctgcagccggaggccgag
cctggctccttgtcagggtccgagagcggcccggcgccccaggatgaacagccggagagg
cccgcggagcctgaccagagcaccgagccgggctcctctccctcggggacagagtcagat
gcacactttgagacctgtctgttggactgtgaaaatcctgccggtgctgcctctcccaaa
gccctgaagccacccaagcggtcccgggctgccttctcccatacccaggtcattgagctg
gagaggaagtttagccaccagaagtatctgtcagctcctgagcgggctcacctagccaaa
aacctcaagctcaccgagacccaggtcaaaatctggttccagaacaggcggtataagacc
aagagaaaacagctgacctctgacctgggagacctcgataagaactccctgcccagccta
aaagaagagaacttctctggggcctcactgatctcaatgtataacagctacccctattat
ccttacctctactgctggggagggtggagcccagctttctggtag

DBGET integrated database retrieval system