KEGG   Phascolarctos cinereus (koala): 110218605
Entry
110218605         CDS       T05867                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04020  Calcium signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04510  Focal adhesion
pcw04540  Gap junction
pcw04630  JAK-STAT signaling pathway
pcw04810  Regulation of actin cytoskeleton
pcw05160  Hepatitis C
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05226  Gastric cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110218605 (EGF)
   04012 ErbB signaling pathway
    110218605 (EGF)
   04014 Ras signaling pathway
    110218605 (EGF)
   04015 Rap1 signaling pathway
    110218605 (EGF)
   04630 JAK-STAT signaling pathway
    110218605 (EGF)
   04066 HIF-1 signaling pathway
    110218605 (EGF)
   04068 FoxO signaling pathway
    110218605 (EGF)
   04020 Calcium signaling pathway
    110218605 (EGF)
   04072 Phospholipase D signaling pathway
    110218605 (EGF)
   04151 PI3K-Akt signaling pathway
    110218605 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110218605 (EGF)
   04540 Gap junction
    110218605 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110218605 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110218605 (EGF)
   05231 Choline metabolism in cancer
    110218605 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110218605 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110218605 (EGF)
   05212 Pancreatic cancer
    110218605 (EGF)
   05226 Gastric cancer
    110218605 (EGF)
   05214 Glioma
    110218605 (EGF)
   05218 Melanoma
    110218605 (EGF)
   05219 Bladder cancer
    110218605 (EGF)
   05215 Prostate cancer
    110218605 (EGF)
   05213 Endometrial cancer
    110218605 (EGF)
   05224 Breast cancer
    110218605 (EGF)
   05223 Non-small cell lung cancer
    110218605 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110218605 (EGF)
   05165 Human papillomavirus infection
    110218605 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110218605 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcw04052]
    110218605 (EGF)
Cytokines and growth factors [BR:pcw04052]
 Growth factors
  Growth factors (RTK binding)
   110218605 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3 Plasmod_Pvs28 GAPT
Other DBs
NCBI-GeneID: 110218605
NCBI-ProteinID: XP_020857029
UniProt: A0A6P5LF99
LinkDB
Position
Unknown
AA seq 1192 aa
MVWLFLLPWPVGFAFSLASLPAPQLQENTSCSLRSAQGDRRVTCAGPAPFLIFSHGNAIF
RIDMEGTNHERMVANAGTSILMDFHYRKKKVYWVDLERGLLQKVFLNGTKKEILGHVEKG
VSGMAIDWLHEEIVWSNQLKGTIETTDMKGNNSHVLLKELNYPKNVVLDPVKSFMFWVAD
NITGTINRANLNGTDVKILMQTSQTIKMISLDIINQRIFWIQYSSAKSDLHVGSCNYDGG
SVHLLNHFTRYPYFGMSLFVEDMYYSEWNTSAIWRANKHTGEKMVKISLKPSFLPPTEIK
VVYQLLQPTARNNTQDSEQESCNLKKGDCRISVCGQDPKSHRCKCAEGYTLSQDGKYCKD
VNECAFWNHGCTLGCENIPGSYYCTCPKGFILLSDGKRCHELISCVSNDTGCSHGCVMTS
DGPACFCPEGSVLEEDGKTCSGCSSLDNGGCSQLCTPLSPVSWECGCFPGYELQLDRKSC
KATGPQPFLLFANTHDIRRIYFDGTKYESLLSQQMGVVLALDHDLVENKIYFAHTTLKWI
ERANMDGSEREILIQEAIDTPESIAVDWINRKFYWTDRGKSHIARSDLNGRHNEVIIEKD
VSQPRGIAVHPTAKKLFWTDLGINPRIESSSLQGSDRLIIANTDLVWPSGITIDYVADKL
YWCDAKQSVIEMANLDGSGRRRLIQNDVDHPFAVAVFEDHVWFSDWAKSSVIRVDKRTGK
NRVCLRGSMLRPSSLVVIHPLAKPGADPCTYKNGGCEHICKETFGIAQCLCQEGFQKTQD
GKKCQSLNSHQTEAGTSKMNLSNDTTALENVLGRTLEDNNRVEQQPKHGLVAEIMVTDED
GCAPVDCGVNAQCTSEGKDAWCQCLEGFTRNGTVCSDIDECEMDNVLCRPESSECINTEG
SYVCKCLEGYSGDGLNCYDIDECETGVHKCGESAICKNTEGGYTCICSNGAPGSGSVCPE
SFQPGDDTSSLIRSRNSECPPPYDSYCLHGGVCIYVSELENYACKCVAGYVGERCQHSDL
EWWEMRHVTMTKQQNITVAVCVVVLVLLLLLALGVTYHFRAQKLHKKNPTPEMNRESTIA
SAPGEGVTLPNHTPSVWVVKEQPDVGVRSHQVSFTDCQTTNGGQPSPPEPGSMCLASGNR
EMQTLEDVGKDQGYQHHLSGGKELSPPEIEGSPHQLPSGGGPLQGASFPCSS
NT seq 3579 nt   +upstreamnt  +downstreamnt
atggtgtggctattcctccttccctggcccgtgggttttgcgtttagcctggccagcctc
ccagccccgcagcttcaggagaacacgagctgctctctgcgctcagcccagggtgacagg
cgtgtaacttgtgcgggtcctgcaccctttttaattttcagccatggaaatgctatcttt
aggattgacatggagggaactaatcatgaacgaatggtggctaacgctggcacgtcgata
ttgatggattttcattatagaaagaagaaagtctattgggtggacttagaaagaggactt
ctgcaaaaagtattcctgaatggcacaaagaaagagattctgggccatgtggagaaaggg
gtttcaggaatggcaattgattggcttcatgaagaaattgtttggtccaatcaactgaaa
ggaacaattgaaactacagacatgaaaggaaacaattctcatgtcctcttgaaggaatta
aattatcctaaaaatgttgttcttgatccagtaaaaagctttatgttttgggtggcagat
aatattactggcactataaacagagccaatcttaatgggacagatgtcaagattctcatg
cagacatcacaaacaattaaaatgatctcattggacatcattaaccagagaatcttttgg
attcagtacagcagtgcaaagagtgatcttcatgttggctcatgtaattatgatgggggc
tccgttcacctgttgaatcattttacacggtacccttattttggaatgtctctctttgtt
gaagatatgtattattccgaatggaatacaagtgccatttggagagccaataaacacaca
ggggagaaaatggtgaaaattagccttaagccatcatttctaccaccaactgaaataaaa
gtagtataccagctcctgcagccaacagcaagaaataatactcaggattctgagcaggaa
tcatgcaacttaaagaagggtgactgcaggatcagtgtgtgtgggcaggaccctaaatct
catcgatgcaaatgtgcagaaggttacacattaagtcaagatgggaagtattgcaaagat
gtcaatgaatgtgcattttggaaccatgggtgtactcttggatgtgaaaatatccctgga
tcctattactgcacatgccccaaagggttcatcctgctttctgatgggaagagatgtcat
gaactaatttcctgtgtaagcaatgacactggatgcagccatggttgcgtcatgacatca
gatggtcccgcgtgtttctgtcctgaagggtcagtgcttgaggaagatggaaaaacgtgc
agtggttgttcatcactagataatggtgggtgtagccagctttgcacccctctcagccca
gtgtcttgggaatgtggttgctttcctggatacgagctgcagttggatcgaaagagctgc
aaagctacaggaccccagccctttttactgtttgccaacacacatgatattcggcgcatc
tactttgatgggacaaagtatgaaagcctgctcagccagcagatgggagtggtcttagca
ttagatcatgatctggttgaaaataagatttactttgcacacacaacactgaagtggata
gagagagctaacatggatggctcagagcgtgaaatactcattcaggaagcaatagacaca
ccggaaagtattgctgtggattggatcaaccgtaaattctattggacagaccgagggaaa
tcacacattgccaggagtgatttgaatggaagacacaatgaagtgatcattgagaaagat
gtgtctcagccaagaggaattgctgtccatccaacggccaagaaattattctggactgat
ttgggaattaatccacggattgaaagctcatctcttcaaggcagtgacaggctgattata
gctaatactgatctggtctggcctagtggaataacgattgattacgtagctgacaagttg
tattggtgcgatgccaaacaatctgttattgaaatggccaatctggatgggtcgggacgc
cgaagacttatccagaacgatgtagatcacccatttgctgtggctgtattcgaggatcat
gtttggttctctgactgggctaagtcttcagtaataagggtggacaagagaactggcaaa
aacagggtatgtcttcgaggcagcatgctgagaccctcatccttggttgtaatccatcct
ttggcaaaaccaggagctgatccctgcacatataaaaatggaggctgtgagcacatttgt
aaagagacatttggaatcgctcaatgcttgtgtcaggaaggctttcagaaaacccaagat
ggtaaaaagtgccagtctctgaacagtcatcagaccgaagcaggtaccagtaagatgaat
ctaagcaatgatacaacagcactggagaatgtgttgggaagaacattggaagataacaac
agggtggagcaacagcccaaacatggactagtagctgaaatcatggttacagatgaggat
ggctgtgcccctgtggattgtggtgtgaatgctcagtgcacttcagagggaaaggatgcc
tggtgtcagtgcttggaaggattcaccaggaatggaaccgtctgctctgatattgatgaa
tgtgaaatggataatgtgctttgccggccagaatcgtctgagtgcatcaacactgagggt
agctatgtctgcaagtgtttggaaggctacagtggagacgggttgaactgttatgatatt
gatgagtgtgaaacgggagtgcacaaatgtggagaaagtgccatctgtaaaaatacagag
ggaggctacacatgcatctgctctaatggtgcacctgggtctggatctgtctgtcctgaa
tcttttcagcctggggatgacacttcctctctcattagaagcaggaattcagagtgtcca
ccaccatatgactcatactgcctccacggaggagtgtgcatttatgtttcagagctagaa
aactatgcatgcaaatgcgtggctggctatgtaggagagcgctgtcagcacagtgacctg
gaatggtgggagatgcggcacgtgacgatgacaaaacagcagaatatcaccgtggctgtc
tgcgtggttgtgctggttctgctgctcctcctggccttgggggtcacttaccatttcagg
gctcagaagctccataagaagaatccaacccccgagatgaacagggaatccaccattgcc
agtgcgcctggagagggtgtgacccttcccaatcacacgccttcggtttgggttgtgaag
gagcaaccagacgtgggggttaggagtcatcaggtgtccttcacagactgtcagaccaca
aatggtggccagccttctccccctgaacctggatctatgtgtctggcatctgggaacaga
gaaatgcagaccttagaagatgtggggaaagatcaaggctaccagcaccacctatctgga
ggcaaagagcttagtcctccggaaatagagggaagtcctcatcagcttccttcaggtggt
ggcccccttcagggagcctcattcccttgttccagctaa

DBGET integrated database retrieval system