KEGG   Phascolarctos cinereus (koala): 110218623Help
Entry
110218623         CDS       T05867                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04012  ErbB signaling pathway
pcw04020  Calcium signaling pathway
pcw04024  cAMP signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04114  Oocyte meiosis
pcw04217  Necroptosis
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04310  Wnt signaling pathway
pcw04360  Axon guidance
pcw04713  Circadian entrainment
pcw04720  Long-term potentiation
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04728  Dopaminergic synapse
pcw04740  Olfactory transduction
pcw04750  Inflammatory mediator regulation of TRP channels
pcw04911  Insulin secretion
pcw04912  GnRH signaling pathway
pcw04916  Melanogenesis
pcw04921  Oxytocin signaling pathway
pcw04922  Glucagon signaling pathway
pcw04925  Aldosterone synthesis and secretion
pcw04934  Cushing syndrome
pcw04971  Gastric acid secretion
pcw05031  Amphetamine addiction
pcw05152  Tuberculosis
pcw05200  Pathways in cancer
pcw05205  Proteoglycans in cancer
pcw05214  Glioma
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110218623 (CAMK2D)
   04310 Wnt signaling pathway
    110218623 (CAMK2D)
   04066 HIF-1 signaling pathway
    110218623 (CAMK2D)
   04020 Calcium signaling pathway
    110218623 (CAMK2D)
   04024 cAMP signaling pathway
    110218623 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110218623 (CAMK2D)
   04217 Necroptosis
    110218623 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110218623 (CAMK2D)
   04922 Glucagon signaling pathway
    110218623 (CAMK2D)
   04912 GnRH signaling pathway
    110218623 (CAMK2D)
   04921 Oxytocin signaling pathway
    110218623 (CAMK2D)
   04916 Melanogenesis
    110218623 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    110218623 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110218623 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    110218623 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    110218623 (CAMK2D)
   04728 Dopaminergic synapse
    110218623 (CAMK2D)
   04720 Long-term potentiation
    110218623 (CAMK2D)
   04722 Neurotrophin signaling pathway
    110218623 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    110218623 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    110218623 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    110218623 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110218623 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110218623 (CAMK2D)
   05205 Proteoglycans in cancer
    110218623 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    110218623 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    110218623 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110218623 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110218623 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110218623 (CAMK2D)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110218623 (CAMK2D)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   110218623 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal SnoaL_4 Kdo SnoaL_2 DUF4915
Motif
Other DBs
NCBI-GeneID: 110218623
NCBI-ProteinID: XP_020857063
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MMASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLE
REARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQ
ILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPG
YLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWD
TVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRK
LKGAILTTMLATRNFSAAKSLLKKADGVKINSKTNVVTSPKENIPTPALEPQTTVIHNPD
GNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEAL
GNLVEGMDFHRFYFENALSKGNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPK
TMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIN
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttcaactacaacctgcaccaggttcaccgacgagtatcagcttttcgaggag
cttggaaagggggcattctcagtggtgagaagatgcatgaaaatccctacaggacaagaa
tatgctgccaaaattatcaacaccaaaaagctttctgctagggatcaccagaaactggaa
cgggaagctagaatctgccgtcttttgaagcaccctaatattgtgcgactccatgacagc
atatcggaagaagggttccattacttagtctttgatttagtcacaggcggtgagctcttc
gaggacatagtggcaagagaatattacagtgaagcagatgccagtcattgtatacagcag
attctagaaagcgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcct
gagaacttgcttttagctagcaaatccaaaggagcagctgtgaaactggcagacttcggc
ttggccatcgaagtccaaggagatcagcaggcatggtttggctttgctggtacacctgga
tacctttccccagaggtgttacgaaaagatccctatggaaaaccagtggatatgtgggca
tgtggtgtgattctctatattctcctggtggggtaccctcctttctgggatgaagaccaa
catagactctaccagcagatcaaggctggagcatatgattttccatcaccagagtgggac
actgtgactcctgaagccaaagaccttatcaataaaatgctcactatcaatcctgccaaa
cgcatcactgcatctgaggcactgaaacatccatggatctgtcaacgttctactgttgct
tctatgatgcacagacaggaaactgtagattgcttgaagaaatttaatgcaagaaggaag
ctgaagggtgccattctcacaaccatgctggctacaagaaatttttcagcagccaagagt
ttgttgaagaaagcggatggagtaaagatcaacagcaaaaccaacgtggtaaccagcccc
aaagaaaatattcctaccccagcgctggagccccaaactacagtaatccacaaccctgat
ggaaacaaggagtccactgagagttccaatacaaccattgaagatgaagatgtgaaagct
cgtaaacaagagattatcaaagttactgagcaacttattgaagcaattaacaatggggac
tttgaagcttacacaaaaatatgtgacccaggtctcactgcttttgaacccgaagctttg
ggtaatttagtggaaggaatggactttcatcgattctactttgaaaatgctttgtccaaa
ggcaataagccaatccacaccatcatcctgaaccctcacgtccatctggtaggcgatgac
gctgcctgcatagcatacatcaggctcacacagtacatggatggcagcggaatgccaaag
actatgcagtcagaagagaccagagtctggcaccgccgtgatggaaagtggcaaaatgtt
cattttcaccgctcgggttcaccaacagtacccatcaactaa

DBGET integrated database retrieval system