KEGG   Phascolarctos cinereus (koala): 110218748
Entry
110218748         CDS       T05867                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04020  Calcium signaling pathway
pcw04022  cGMP-PKG signaling pathway
pcw04024  cAMP signaling pathway
pcw04260  Cardiac muscle contraction
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04270  Vascular smooth muscle contraction
pcw04713  Circadian entrainment
pcw04720  Long-term potentiation
pcw04723  Retrograde endocannabinoid signaling
pcw04724  Glutamatergic synapse
pcw04725  Cholinergic synapse
pcw04726  Serotonergic synapse
pcw04727  GABAergic synapse
pcw04728  Dopaminergic synapse
pcw04742  Taste transduction
pcw04911  Insulin secretion
pcw04912  GnRH signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04924  Renin secretion
pcw04925  Aldosterone synthesis and secretion
pcw04927  Cortisol synthesis and secretion
pcw04929  GnRH secretion
pcw04930  Type II diabetes mellitus
pcw04934  Cushing syndrome
pcw04935  Growth hormone synthesis, secretion and action
pcw05010  Alzheimer disease
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05031  Amphetamine addiction
pcw05410  Hypertrophic cardiomyopathy
pcw05412  Arrhythmogenic right ventricular cardiomyopathy
pcw05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110218748 (CACNA1C)
   04020 Calcium signaling pathway
    110218748 (CACNA1C)
   04024 cAMP signaling pathway
    110218748 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    110218748 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110218748 (CACNA1C)
   04929 GnRH secretion
    110218748 (CACNA1C)
   04912 GnRH signaling pathway
    110218748 (CACNA1C)
   04921 Oxytocin signaling pathway
    110218748 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    110218748 (CACNA1C)
   04924 Renin secretion
    110218748 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    110218748 (CACNA1C)
   04927 Cortisol synthesis and secretion
    110218748 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110218748 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    110218748 (CACNA1C)
   04270 Vascular smooth muscle contraction
    110218748 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    110218748 (CACNA1C)
   04727 GABAergic synapse
    110218748 (CACNA1C)
   04725 Cholinergic synapse
    110218748 (CACNA1C)
   04728 Dopaminergic synapse
    110218748 (CACNA1C)
   04726 Serotonergic synapse
    110218748 (CACNA1C)
   04720 Long-term potentiation
    110218748 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    110218748 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    110218748 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110218748 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110218748 (CACNA1C)
   05020 Prion disease
    110218748 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    110218748 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    110218748 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110218748 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110218748 (CACNA1C)
   05414 Dilated cardiomyopathy
    110218748 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110218748 (CACNA1C)
   04934 Cushing syndrome
    110218748 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcw04040]
    110218748 (CACNA1C)
Ion channels [BR:pcw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110218748 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel DUF4834
Other DBs
NCBI-GeneID: 110218748
NCBI-ProteinID: XP_020857335
LinkDB
Position
Unknown
AA seq 2195 aa
MLQAFVKSTTPAYQTLPSHLPAETERKFKGTLVNEAQLNCFYISHEGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQK
KQGSTTATRPPRALLCLTLXNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGLTDAPVEDDPSPCALDTGHGRQCQNGT
ICKAGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNIFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVEKPAVEETKEEKIELKSITA
DGESPPTTKINVDDLQPNENEEKGSYPNPEAGGEEEEEEPEMPVGPRPRPLSELHLKEKA
VPMPEASAFFIFGHNNRFRLQCHRIVNNNVFTNLILFFILLSSISLAAEDPVRHNSFRNQ
ILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAI
NVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLF
KGKLYTCTDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLTAMMALFTV
STFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQE
QGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILL
NTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIV
IGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRI
SITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFG
KIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACLPGKKCAPESEPSNSTEP
ETLCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAE
YDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLF
ALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFL
IQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAM
KEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSSFPQTFTTQRPLHINKAGNSQGDTESP
SHEKLVDSTFTPSSYSSSGSNANINNANNTALGRFPCPTGYPSTVSTVEGHGTPLSPAIR
VRETAWKLSSRRYHSRDSRIAMVCPEEVAPNKSYEGNVNEDTEYCSEPSLISTEMLSYQD
DENRQLTPPEDKTRQSTKRGFLHSSSLGRRASFHLECLKIQKNRGGDISQKTVLPLHLVH
HQALAVTGLSPLLQRSHSPNTTFPRPSATPPESPHGHAWPLQPIPTLWLEGAESNEKLNS
SFPSIHCSSWYAENANCGGSRGSTSRRARPVSLTVPSQSGAAGRQFHGSASSLVEAVLIS
EGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGSSKQSPNGNLLPFINCRDP
GQDQAGGEEEEGVPNPECRKSEEELQDSRVYISSL
NT seq 6588 nt   +upstreamnt  +downstreamnt
atgcttcaagcctttgttaaatcaactactcctgcatatcaaacattacctagtcacctt
ccagcagaaacagagaggaagtttaagggtactttggtgaatgaagctcaactcaactgt
ttctacatctcacacgaaggttccaactatgggagccctcgcccagctcatgccaacatg
aatgccaatgccgcggcagggcttgctcctgagcacatccccaccccaggagcggccctc
tcatggcaggcggccatcgatgctgcccggcaagccaagttgatgggcagtgctggcaat
gctaccatctccaccgccagctctactcagaggaaacggcagcagtatgggaaacagaag
aagcaagggagcacaacagccactcgcccaccccgtgcattgctgtgcctgaccctgnaa
aaccccatccggagagcatgcataagcattgttgaatggaaaccatttgaaatcattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagat
gattccaatgccaccaattccaacctggaacgagtggaatatctctttctcatcattttt
acagtggaagcatttttaaaagtaatagcatatggacttctctttcaccccaatgcttac
ctccgcaacggttggaatttactagattttataattgtggtagtagggctgtttagtgca
attttagaacaagcaaccaaagcagatggggcaaatgcattaggaggaaaaggggctgga
tttgatgtaaaggccctgagggctttccgagtgctgcgtcccttacgcctggtgtctgga
gtgccaagtctacaagtggttttaaattccatcatcaaggccatggttccgctgctgcat
atcgccctgcttgtgctatttgtcataatcatctatgccatcattgggctggagctcttc
atggggaagatgcacaagacttgctacaatcaggagggtttaacagatgccccagtagaa
gatgacccttctccttgcgcccttgacacgggacatggacggcaatgccagaatggcacg
atatgtaaagcagggtgggatggacccaaacacggcatcaccaactttgacaatttcgcc
ttcgccatgttaactgtgttccagtgcattacaatggagggttggacagatgtgctatac
tggatgcaagacgcaatgggctatgagttaccttgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgtattgagcggagagttttccaaa
gagagagagaaggcaaaggctcgaggagacttccaaaagctgcgagagaagcagcagcta
gaggaggacctcaaaggctacctggactggattactcaagctgaagatattgaccctgag
aatgaagatgaaggcatggatgaggagaagcccagaaacatgagcatgcccacaagtgag
acagagtcggtcaacactgaaaatgtggctggaggcgacatcgagggagagaactgtggg
gcaaggctggcgcaccgaatctccaaatcaaagttcagccgctactggcgccggtggaac
cggttctgcagaaggaagtgtcgggctgctgtcaaatccaatattttctactggcttgtt
attttccttgtatttctcaacacccttaccatcgcctcagagcactacaaccagccccac
tggctcacagaagtccaagatactgccaacaaggccctgctggctcttttcactgcagag
atgctgttgaagatgtacagccttggcctccaggcctactttgtgtctctgttcaaccgc
tttgactgcttcatcgtgtgtggaggaatcctggagaccatcctggtagagaccaagatc
atgtcccccctggggatctcagtgttgagatgtgtccggctgctgaggatattcaaaatt
acaaggtattggaactccttgagcaacctggtagcatcattactgaattcagtgcgatca
attgcctcactcctgctgctcctttttcttttcatcatcatcttctctctcctggggatg
cagctctttggtggaaagttcaactttgacgagatgcagacccggaggagcacatttgat
aatttcccccagtctcttctcactgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggagggccctcttttccagggatgttagtctgt
atttacttcatcatccttttcatctgtggaaactacatcttactgaatgtattcttggcc
attgctgtggacaatctggctgatgccgagagcctcacatctgcccagaaagaagaggag
gaggaaaaagaaaggaagaagctagccaggactgccagccctgaaaagaagcaagaggtg
gaaaaaccagcagtggaggagactaaggaggagaaaattgagctaaagtcaattactgct
gatggggagtctccacccaccaccaagatcaacgtggatgacctccagcccaatgaaaat
gaggagaaaggttcctatcccaacccagaagctggaggagaagaagaagaggaagagcct
gagatgcctgtggggccccgccctcgcccactctctgagttacacctcaaggaaaaggca
gtacccatgccagaagccagtgcatttttcatctttggccataacaacaggttccgtctt
cagtgtcaccgcattgtcaacaacaatgtctttaccaatctgatcctcttcttcattctg
ctcagcagcatctccctggctgctgaggacccagtccgacacaactcctttcggaaccaa
attctgttttattttgatatagtttttactaccattttcaccattgaaattgctctgaag
atgaccgcctatggggctttcctccacaagggctctttctgcaggaactacttcaacatc
ttggacctcctcgtggtcagcgtgtccctgatctccttcggtatccagtccagtgccatc
aatgttgtcaagatcttgagagttcttagagtactcagacccctgagagctatcaacagg
gccaagggattaaagcatgtggtccagtgtgtgtttgttgctatccgaacgatagggaat
attgtgattgtcaccacacttctgcaattcatgtttgcctgcattggggtacagctgttc
aagggcaaactctacacctgtacagacagttccaaacagaccgaggctgaatgcaagggc
aactatatcacatacaaagatggtgaggtagatcatcccatcattcagcctcgaagttgg
gaaaatagcaagtttgactttgacaatgtcctgactgccatgatggccctcttcactgtc
tccacctttgaggggtggccagagcttctataccgatccatcgactcacacactgaagat
aagggacccatctacaactaccgagtagagatctccatcttcttcatcatctacatcatc
atcatcgccttctttatgatgaatatctttgtgggtttcgtcattgtcaccttccaggag
cagggagaacaggagtacaagaactgtgaactggacaagaaccagcgacagtgtgtcgag
tatgctctcaaggctcggcccttgagaaggtacatccccaagaaccagcaccagtacaaa
gtgtggtatgttgtcaattccacctattttgagtacttgatgttcgtcctcatccttctc
aacaccatctgcttggccatgcagcactacggtcagagctgtcttttcaaaatcgctatg
aacattctcaacatgctcttcaccggcctgttcactgtggagatgatcctgaagctcatt
gcattcaaacccaagggttactttagtgatccttggaatgtttttgacttcctgatcgta
attggcagcattattgacgtcattctcagtgaaactaatcactatttctgtgatgcatgg
aatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggta
aacccagctgaacatacccaatgctctccctctatgaatgcagaggagaactcccgaatc
tccatcaccttctttcgtctcttccgggttatgcgtcttgtcaagttgctgagccgtggg
gagggcatccgaaccctgctctggactttcatcaaatcttttcaggctctaccctatgtg
gctcttctgatagtgatgctgttcttcatctatgctgtcattggaatgcaggtgtttggc
aaaatcgccctgaatgataccacggaaatcaatcggaacaacaactttcagaccttccct
caagctgtgctgctactcttcaggtgtgctacaggggaggcatggcaagatatcatgcta
gcctgtctgccaggaaagaagtgtgcccctgagtctgagccaagtaatagtactgaacca
gagacactctgtggcagcagctttgctgtcttctattttatcagtttctacatgctctgt
gccttcctgatcatcaacctctttgtagccgtcatcatggacaacttcgactacctgaca
agagactggtccatcctaggtccccatcacttggatgagttcaaaaggatctgggcagaa
tatgaccccgaagccaagggccgtatcaaacacctggatgtagtgaccttactccgaagg
atccaacccccactagggtttggaaagctgtgccctcatcgagtagcatgcaaacgtctg
gtctccatgaacatgcctctgaacagtgatgggactgttatgttcaatgctacattgttt
gctctggtcaggacagccttgaggatcaaaacagaagggaacctggaacaagccaatgaa
gagttgcgagcaattatcaaaaagatctggaaacggactagcatgaagctcctagatcaa
gtagttcccccagctggtgatgatgaagtgactgttgggaagttctatgccaccttcctg
atccaagaatatttccgaaaatttaagaaacgcaaagagcaaggactggtgggcaagccc
tcccaaaggaatgcgctgtctctacaggctggtcttcgtacactgcatgacatcggacca
gagattcgacgggccatctctggggacctgacagctgaggaggagttggacaaggctatg
aaggaagctgtttctgctgcctcggaagatgacatctttaggagggccggtggcctgttt
ggcaatcatgtcagctactaccaaagcgatggtcgaagctccttcccccagaccttcacc
acccagcgcccactgcatatcaacaaggcgggtaacagtcaaggcgacacggagtcacca
tcccatgagaaactggtggactccacattcactcccagcagctactcatcctctggttcc
aatgccaacatcaacaacgccaacaacactgccctgggccgcttcccctgtcccaccggt
taccccagtacggtcagcacagtggagggccatgggacccccttgtcccctgccatccgg
gtgcgcgagacagcatggaagctcagctccaggagataccactcccgggacagccggata
gccatggtgtgcccagaggaggtagcccccaacaagagctatgaagggaatgtgaatgaa
gacacagaatactgcagcgagcccagtctgatctccactgagatgctatcctatcaggat
gatgagaatagacagctgacaccaccagaagacaagaccaggcagtctacgaaaagagga
ttcctccactcttcctcactaggtcgaagagcctccttccatttggagtgtctaaagata
caaaagaaccgagggggagacatctctcagaagacagtgctgcccttgcatctggttcat
caccaggcattggcagtgacaggcctcagccctctccttcagagaagccattctccaaac
accacattccccaggccaagtgccacccccccagaaagtcctcatggccacgcctggccc
ctccagcccattcctacactgtggctagaaggagcagaatccaacgaaaagctcaacagc
agcttcccttcaatccactgcagctcctggtatgcagaaaatgccaactgtgggggcagc
aggggcagcacctcccggagagcccggccagtctccctcactgtgcccagccagtctggg
gcagctggcagacaattccacggcagtgcaagcagtctagttgaagcggtcttgatttca
gaaggactgggacaatttgctcaagatcccaagttcatcgaagtcacaacccaagaactt
gctgatgcctgtgatatgacaatagaagaaatggagaatgcagctgacaatatcctcagt
ggtagcagcaagcagagccccaatggcaacctattaccttttattaactgcagggacccg
gggcaggaccaagcaggtggtgaggaggaagaaggagtgcccaaccccgaatgtcgaaag
agtgaggaggaactccaggacagcagggtttatatcagcagcctgtag

DBGET integrated database retrieval system