KEGG   Phascolarctos cinereus (koala): 110219058Help
Entry
110219058         CDS       T05867                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3 isoform X1
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04068  FoxO signaling pathway
pcw04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110219058
   04151 PI3K-Akt signaling pathway
    110219058
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110219058
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110219058
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   110219058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PX Pkinase_C Kinase-like FTA2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110219058
NCBI-ProteinID: XP_020857828
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRNEWFVFRRYAEFDKLYNTLKKQFP
TMTMKIPAKRIFGDNFDPDFIKQRRTGLNEFIQNLVRHPELCNHPDVRAFLQMDSPRHQS
DPSEDEDERSIQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGK
FYAVKVLQKKIVLKRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGG
ELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSIGHVVLTDFG
LCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDV
AEMYENILHKPLNLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLNWTD
LAQKKIPPPFNPNVVGPDDIRNFDAAFTEEMVPYSVCISSDYSIVNASVLEADDAFVGFS
YAPPSEDLFL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggactacaaagagagctgcccaagtgttagcatcccaagctctgatgaacacagggag
aaaaaaaagaggttcactgtttataaagtattagtttcagttggaaggaatgaatggttt
gtcttcaggagatatgctgaatttgataagctttataacacactaaagaaacagtttcca
actatgacaatgaagattcctgccaaaagaatatttggtgataattttgatccagatttt
attaaacagagaagaacaggactgaatgaattcattcagaatttagttagacatccagag
ctatgcaaccatccagatgtcagagcatttcttcaaatggatagtccacgacatcagtca
gatccttctgaagatgaggatgaaagaagtattcagaagctacactctacctcacagaac
atcaacctgggaccatctggaaatcctcatgccaaaccaacagattttgatttcctaaaa
gttattggaaaaggcagctttggcaaggttcttcttgcaaaaaggaaactagatggaaaa
ttttatgctgtcaaagtgttgcagaaaaaaattgttctgaaaaggaaagagcaaaaacat
attatggctgaacgtaatgtgctcttgaaaaatgtgaagcatccatttttggttggatta
cattattcattccagacaactgaaaagctttattttgttttggattttgttaatggaggg
gaacttttctttcacttacaaagagaacggtcctttccagaacacagagccagattttat
gctgcagaaattgccagtgctttgggctacttgcattctataaaaatagtatacagggac
ttgaaaccagaaaacattcttttggattcaataggacatgtcgttttaacagattttggg
ttatgtaaagaagggattgctatatctgacacaactacaacgttttgtgggacaccagag
taccttgcaccagaagtgatcagaaaacagccctatgacaatactgtagattggtggtgc
cttggtgccgttctgtatgaaatgctgtatgggttgcctccattttattgtcgagatgtt
gctgagatgtatgaaaatatactccataaacccctaaatttgaggccaggagtgagcctc
acagcctggtccatcctagaagaacttcttgaaaaagacaggcaaaatcgactcggtgcc
aaagaagactttcttgaaattcaaaatcatcctttctttgaatcactcaactggactgac
cttgcacaaaaaaagattccaccaccttttaatcctaatgtggttggaccagatgacatc
aggaactttgatgcagcctttacagaagaaatggttccatattctgtttgtatatcttct
gactattccatagtgaatgccagtgttttggaggcagatgatgcatttgttggtttctct
tatgcacctccttctgaagatttgtttttgtaa

DBGET integrated database retrieval system