KEGG   Phascolarctos cinereus (koala): 110219266
Entry
110219266         CDS       T05867                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04062  Chemokine signaling pathway
pcw04068  FoxO signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04380  Osteoclast differentiation
pcw04510  Focal adhesion
pcw04540  Gap junction
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04630  JAK-STAT signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04714  Thermogenesis
pcw04722  Neurotrophin signaling pathway
pcw04910  Insulin signaling pathway
pcw04912  GnRH signaling pathway
pcw04915  Estrogen signaling pathway
pcw04917  Prolactin signaling pathway
pcw04926  Relaxin signaling pathway
pcw04935  Growth hormone synthesis, secretion and action
pcw05034  Alcoholism
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110219266 (GRB2)
   04012 ErbB signaling pathway
    110219266 (GRB2)
   04014 Ras signaling pathway
    110219266 (GRB2)
   04630 JAK-STAT signaling pathway
    110219266 (GRB2)
   04068 FoxO signaling pathway
    110219266 (GRB2)
   04072 Phospholipase D signaling pathway
    110219266 (GRB2)
   04151 PI3K-Akt signaling pathway
    110219266 (GRB2)
   04150 mTOR signaling pathway
    110219266 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110219266 (GRB2)
   04540 Gap junction
    110219266 (GRB2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110219266 (GRB2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110219266 (GRB2)
   04660 T cell receptor signaling pathway
    110219266 (GRB2)
   04662 B cell receptor signaling pathway
    110219266 (GRB2)
   04664 Fc epsilon RI signaling pathway
    110219266 (GRB2)
   04062 Chemokine signaling pathway
    110219266 (GRB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110219266 (GRB2)
   04912 GnRH signaling pathway
    110219266 (GRB2)
   04915 Estrogen signaling pathway
    110219266 (GRB2)
   04917 Prolactin signaling pathway
    110219266 (GRB2)
   04926 Relaxin signaling pathway
    110219266 (GRB2)
   04935 Growth hormone synthesis, secretion and action
    110219266 (GRB2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110219266 (GRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110219266 (GRB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110219266 (GRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110219266 (GRB2)
   05206 MicroRNAs in cancer
    110219266 (GRB2)
   05205 Proteoglycans in cancer
    110219266 (GRB2)
   05203 Viral carcinogenesis
    110219266 (GRB2)
   05231 Choline metabolism in cancer
    110219266 (GRB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110219266 (GRB2)
   05225 Hepatocellular carcinoma
    110219266 (GRB2)
   05226 Gastric cancer
    110219266 (GRB2)
   05214 Glioma
    110219266 (GRB2)
   05221 Acute myeloid leukemia
    110219266 (GRB2)
   05220 Chronic myeloid leukemia
    110219266 (GRB2)
   05211 Renal cell carcinoma
    110219266 (GRB2)
   05215 Prostate cancer
    110219266 (GRB2)
   05213 Endometrial cancer
    110219266 (GRB2)
   05224 Breast cancer
    110219266 (GRB2)
   05223 Non-small cell lung cancer
    110219266 (GRB2)
  09165 Substance dependence
   05034 Alcoholism
    110219266 (GRB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110219266 (GRB2)
   05160 Hepatitis C
    110219266 (GRB2)
   05163 Human cytomegalovirus infection
    110219266 (GRB2)
   05165 Human papillomavirus infection
    110219266 (GRB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110219266 (GRB2)
   01522 Endocrine resistance
    110219266 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110219266 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pcw04990]
    110219266 (GRB2)
Membrane trafficking [BR:pcw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    110219266 (GRB2)
Domain-containing proteins not elsewhere classified [BR:pcw04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   110219266 (GRB2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 SH2_2 hSH3 DUF5093 SH3_4
Other DBs
NCBI-GeneID: 110219266
NCBI-ProteinID: XP_020858133
UniProt: A0A6P5LKM7
LinkDB
Position
Unknown
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLGKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNRNI
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaagccatcgccaaatacgacttcaaagccactgcagatgatgagttgagcttcaaa
aggggtgacatcctcaaggtgttgaatgaagaatgtgatcaaaattggtataaggcagaa
ctcaatggaaaagatggcttcattcccaagaactatatagaaatgaaaccacatccgtgg
ttttttggcaaaatccccagagcaaaggcagaagaaatgcttggcaaacagcgacatgat
ggtgcctttcttatccgggagagtgagagtgcaccaggggacttctccctctctgtcaag
tttggaaatgatgtgcagcatttcaaggtgctccgagatggggctggaaagtatttcctt
tgggtggtaaagttcaattctttaaatgagctggtagattatcacagatccacctcggtt
tccagaaaccagcagatattcttgcgggacatagaacaggtgccacagcaaccaacatat
gtccaggccctctttgactttgacccccaagaagatggagagctgggcttccgtcgggga
gatttcatacaggtccttgataactcagaccccaactggtggaaaggagcctgccatggg
cagaccggcatgtttccacgtaactacgtcaccccagtgaaccggaacatctaa

DBGET integrated database retrieval system