KEGG   Phascolarctos cinereus (koala): 110219776
Entry
110219776         CDS       T05867                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04071  Sphingolipid signaling pathway
pcw04115  p53 signaling pathway
pcw04141  Protein processing in endoplasmic reticulum
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04215  Apoptosis - multiple species
pcw04217  Necroptosis
pcw04722  Neurotrophin signaling pathway
pcw04932  Non-alcoholic fatty liver disease
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw05012  Parkinson disease
pcw05014  Amyotrophic lateral sclerosis
pcw05016  Huntington disease
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05132  Salmonella infection
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05162  Measles
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05168  Herpes simplex virus 1 infection
pcw05169  Epstein-Barr virus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05203  Viral carcinogenesis
pcw05210  Colorectal cancer
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05216  Thyroid cancer
pcw05217  Basal cell carcinoma
pcw05218  Melanoma
pcw05220  Chronic myeloid leukemia
pcw05222  Small cell lung cancer
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110219776 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    110219776 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110219776 (BAX)
   04215 Apoptosis - multiple species
    110219776 (BAX)
   04217 Necroptosis
    110219776 (BAX)
   04115 p53 signaling pathway
    110219776 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110219776 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    110219776 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110219776 (BAX)
   05202 Transcriptional misregulation in cancer
    110219776 (BAX)
   05203 Viral carcinogenesis
    110219776 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110219776 (BAX)
   05212 Pancreatic cancer
    110219776 (BAX)
   05225 Hepatocellular carcinoma
    110219776 (BAX)
   05226 Gastric cancer
    110219776 (BAX)
   05214 Glioma
    110219776 (BAX)
   05216 Thyroid cancer
    110219776 (BAX)
   05220 Chronic myeloid leukemia
    110219776 (BAX)
   05217 Basal cell carcinoma
    110219776 (BAX)
   05218 Melanoma
    110219776 (BAX)
   05213 Endometrial cancer
    110219776 (BAX)
   05224 Breast cancer
    110219776 (BAX)
   05222 Small cell lung cancer
    110219776 (BAX)
   05223 Non-small cell lung cancer
    110219776 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110219776 (BAX)
   05014 Amyotrophic lateral sclerosis
    110219776 (BAX)
   05016 Huntington disease
    110219776 (BAX)
   05020 Prion disease
    110219776 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    110219776 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110219776 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110219776 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110219776 (BAX)
   05152 Tuberculosis
    110219776 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110219776 (BAX)
   05170 Human immunodeficiency virus 1 infection
    110219776 (BAX)
   05161 Hepatitis B
    110219776 (BAX)
   05160 Hepatitis C
    110219776 (BAX)
   05164 Influenza A
    110219776 (BAX)
   05162 Measles
    110219776 (BAX)
   05168 Herpes simplex virus 1 infection
    110219776 (BAX)
   05163 Human cytomegalovirus infection
    110219776 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110219776 (BAX)
   05169 Epstein-Barr virus infection
    110219776 (BAX)
   05165 Human papillomavirus infection
    110219776 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110219776 (BAX)
   01524 Platinum drug resistance
    110219776 (BAX)
   01522 Endocrine resistance
    110219776 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pcw03029]
    110219776 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcw02000]
    110219776 (BAX)
Mitochondrial biogenesis [BR:pcw03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    110219776 (BAX)
Transporters [BR:pcw02000]
 Other transporters
  Pores ion channels [TC:1]
   110219776 (BAX)
SSDB
Motif
Pfam: Bcl-2 Bclx_interact
Other DBs
NCBI-GeneID: 110219776
NCBI-ProteinID: XP_020859090
UniProt: A0A6P5LL18
LinkDB
Position
Unknown
AA seq 200 aa
MDGYGEQPRGGGDPEATSSEQIMRTGAVLLQGFIQDRAGRVAGGAPELVLDSMGDSAPLP
SDPRTKRLTECLRRIGDELDSNMELQRMIAAVETDSPREVFFRVAAEMFSDGNFNWGRVV
ALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLTWIQEQGGWDGLLSYFGTPTWQ
TVTIFVAGILTASLTIWKMS
NT seq 603 nt   +upstreamnt  +downstreamnt
atggacggctacggggagcagccgcgaggcggtggcgatccggaggccacgagcagtgag
cagatcatgaggaccggggccgtgctgctgcaggggttcatccaggaccgcgcgggccgg
gtggctgggggcgcccccgagctggtcctggattccatgggagactcggccccgctgccc
tcggacccccggaccaagcggctgaccgagtgcctgcgcaggatcggggacgagctggac
agcaacatggagctgcagaggatgatcgccgcggtggagaccgactctccccgggaggtc
tttttccgagtggccgccgagatgttctccgacggcaacttcaactggggccgggtcgtg
gccctcttctattttgctagcaagcttgtgctcaaggcactctgcaccaaggtcccggag
ctgatccgaaccatcatgggctggaccctagacttcctgagagaacggctgctcacctgg
atccaggagcagggtggctgggatggcctcctctcttactttgggacaccaacctggcag
acagttaccatcttcgtggctggcatccttacagcttcgcttaccatctggaagatgtcc
tag

DBGET integrated database retrieval system