KEGG   Phascolarctos cinereus (koala): 110219937Help
Entry
110219937         CDS       T05867                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110219937 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcw03036]
    110219937 (KMT5C)
Enzymes [BR:pcw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110219937 (KMT5C)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110219937 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 110219937
NCBI-ProteinID: XP_020859354
LinkDB All DBs
Position
Unknown
AA seq 468 aa AA seqDB search
MGPERVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALETFRRQRD
LEAAYRALTLGGWMAHYFQSRGPQQEAALKTHIYRYLRAFLPESGFAILPCTRYSLETNG
AKVVSTRSWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCRPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGDGFFGDRNELCECCTCERKGEG
AFRLRPRDAAAATPRTCEKYDLRETERRLQRYWEARGMRQGLGPLGAQRCSHLHTLRRLD
LLCALCQPLHLQPFGTHLDASALWVQWLPRPHPPRRRRRRRRPPRRRSARSAPHPRVPRV
SLHQWGGCGPRCRLQGEVAVALNPAPASAPARPAPLQDWHWARQYGLPRVVRVDLSGAGP
VPTAPASLRPMGPEPPKRTLAFGPFSPPKRLRLVVSHGSIALDINGGH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggggccggagagggtgacagccagggagctgtgtgagaatgatgaccttgccaccagc
ctggtcctcgacccctacctgggcttccgcacgcacaagatgaacgtcagcccggtgccc
cctctgcgtcggcagcaccacctgcgctcggcgctggagactttccggaggcagcgggac
ttggaggcggcctaccgggccctgaccctgggcggctggatggcccactacttccagagc
cgtggcccgcagcaggaggctgccctcaagacccatatctaccgataccttcgagccttc
ctgcctgaaagcggatttgccatccttccctgtacccgatactccctggaaaccaacggg
gccaaggtcgtgtctacacgctcctggaagaagaatgagaagctggagctgctggtgggg
tgcatcgccgagttgcgggaggccgacgagggcttgctccgggccggcgagaatgatttc
agcattatgtactccacacggaaacgcagcgcccagctgtggctgggccccgcagccttc
atcaaccatgactgcagacccaattgcaagtttgtgcccgcagacgggaatgcagcctgc
gtgaaggtgctccgagacattgagcccggggacgaagtgacctgcttctatggggatggc
ttttttggggatcgaaatgagctttgtgagtgctgcacatgtgagaggaagggagaaggc
gcctttcgcctgcggccccgggatgcggcagccgccactcccaggacttgtgagaagtat
gacctccgagagactgagaggcgtcttcagcgttactgggaggcccgagggatgcgacag
ggtcttgggcctctgggggctcagcgctgttcgcatctgcacaccttgcgccgtctggac
ctcctgtgtgcgctctgccagccccttcacctgcagcctttcggtactcatttggatgcc
tctgccttgtgggtacagtggctgccgcggccccaccctccccgccgccgccgtcgccgc
cgccgtcccccccgccgtcggtcagcccggtcagccccgcaccctcgggtcccccgggtc
tccctgcaccagtggggaggctgtggtccacggtgccgccttcagggggaggtcgctgtg
gccttgaacccagcccctgcctcagccccagctcggcctgccccactgcaggactggcat
tgggcccggcaatatggcctaccccgtgtggttcgagtggacctgagtggtgccggcccg
gtccctaccgcccctgccagccttaggcctatgggccccgagcctcccaagcggaccctg
gcctttggccccttctctccacctaaacgtctgcgcctcgtggtcagccatggctccatc
gccctagatattaacggggggcactga

DBGET integrated database retrieval system