KEGG   Phascolarctos cinereus (koala): 110220175Help
Entry
110220175         CDS       T05867                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw03030  DNA replication
pcw03410  Base excision repair
pcw03420  Nucleotide excision repair
pcw03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110220175 (LIG1)
   03410 Base excision repair
    110220175 (LIG1)
   03420 Nucleotide excision repair
    110220175 (LIG1)
   03430 Mismatch repair
    110220175 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcw03032]
    110220175 (LIG1)
   03400 DNA repair and recombination proteins [BR:pcw03400]
    110220175 (LIG1)
Enzymes [BR:pcw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110220175 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     110220175 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110220175 (LIG1)
DNA replication proteins [BR:pcw03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110220175 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110220175 (LIG1)
DNA repair and recombination proteins [BR:pcw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110220175 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     110220175 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     110220175 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR Glyco_hydro_92
Motif
Other DBs
NCBI-GeneID: 110220175
NCBI-ProteinID: XP_020859767
LinkDB All DBs
Position
Unknown
AA seq 887 aa AA seqDB search
MQRSIKSFFQPMSGDRVRKQEEPPKSSKEREPTSKAALKERNAVEPESESPVKRPMRKVP
RVLGSEGEEEDHEEVAPTAPPDQKPSVPSRAPSPASSGPSPSDSSPHGISPAGIPKRRTA
RKQMQKRKLKELPEDHEGQVPKRLKREGGESAQGRSPERPASIREAQRAPEPQGASEEAR
RGPEPKAPARAPKAFSSFFTPQKPAAAKQTPKEAETGKAAEETSRAPLDPATYDPSKSSY
HPLDDACWKPGQRVPYLIVARTFEKIEEVSARLRMVETLSNLLRSVTALSPTDLLPILYL
SLNQLGPPQQGLELGVGDGVLLKAVAQATGRQLEAIRAEMAERGDVGLVVEASRSTQRTM
LPLPPLTASGVLSKLRDIARLTGSASTSKKIDIIKGLFVACRHSEARFIARALSGRLRLG
LAEQSVLAALAQAVTLTPPGQEFPPAVVDAGTGKLAEARKTWLEEKGMILKQTFCEVPDL
DLIVPALLEHGLDQLPQHCQLTPGVPLKPMLAHPTRGIGEVLKRFEESAFTCEYKYDGQR
AQIHVLANGDVKIFSRNQEDNTGRYPDVISRIPKMKHPSVISCILDAEAVAWDRVKKQIQ
PFQVLSTRKRKEVEEAEIQVQVCLYAFDLIYLNGQSLVREPLSRRRQQLRENFIETEGEF
VFATSLDTKDTEQIADFLEQSVKDSCEGLMVKTLDTNATYEIAKRSHNWLKLKKDYLEGI
GDTLDLVLIGAYLGRGKRAGRYGGFLLAAFDEDSEEFQAICKLGTGFSDEELEEHYQSLQ
ALVIPAPRSYVRAEGAVPPDHWLEPTTVWEVKCADLSVSPIYSAARGLVESDKGVSLRFP
RFVQVRKDKKPEEATSSAQVANLYKKQQQIQNQQDSKSPTFEPEDFC
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgatcgataaagtcgtttttccagcctatgagcggggacagagtgaggaagcag
gaggagccccccaaaagcagcaaggagagagagcccacctccaaggctgccctgaaggag
aggaatgctgtagaacctgagagtgagtcccccgtgaagaggcctatgaggaaagtgccc
cgagtcctagggagtgaaggcgaggaggaggaccacgaggaggtggccccgacagccccc
ccagaccagaagcccagcgtcccctcccgggccccttctccagccagctccggcccgtcc
ccctcagactcctcgccccacggcatctccccagcagggatcccaaagcgtcggacagct
cggaaacagatgcagaaacgtaagctgaaggagctgcctgaggaccatgagggccaggtg
cccaagaggcttaagagggagggaggcgagagtgcacaagggagaagccctgagcggccc
gcctcgatccgtgaggcacagcgggcccccgagccgcagggcgcctcggaggaggcgagg
cgaggcccggagccaaaggcacccgcccgggcacccaaggccttcagcagctttttcacc
ccccaaaagccggcagcagcaaagcagaccccaaaggaggcagagacagggaaggcagca
gaggagacatccagggcgcccctagacccagccacatacgacccttctaagagcagctat
caccccctggacgacgcatgctggaaaccagggcagagggtcccctacctcattgtagct
cggacatttgagaaaattgaggaagtctctgctcggctccggatggtggaaacgctgagc
aacctcctccggtcagtgaccgccctgtcccccacagacctgctccctatcctctacctg
agtctcaaccagctgggccccccccagcaaggcctggagctcggcgtgggggacggcgtg
ctcctcaaggcggtggcccaagccacagggcggcaactggaagccatacgggccgagatg
gcagaaaggggggacgtggggttggtggtagaggccagccgcagcacccagcgtaccatg
ctgcccctgccccccctgacggcatcaggggtcctgagcaagctccgagacatcgcccgc
ctcacaggcagcgcttccacatcaaagaagatcgacatcatcaaaggcttgtttgttgcc
tgtcgccactcggaggcccgcttcattgccagggccctgagtgggcggctgcgcctgggc
cttgccgaacagtcggtgctggccgcacttgcccaggccgtgaccctcacgccccctggc
caagagttccccccggctgtggtagatgctgggacaggcaagttggcagaagccagaaag
acttggctggaagagaagggcatgatcctgaagcagaccttctgcgaggtgcctgacctg
gacctgattgtccctgccctgctcgagcacgggctggaccagctgccccagcactgccag
ctgaccccaggggtacccctgaagcccatgctggcccaccccacccgcggcattggggag
gtgttgaagcgcttcgaggagtctgccttcacatgtgaatataagtatgatgggcagaga
gcacagatccatgtcctggcaaacggggacgtgaagatatttagccggaaccaggaggat
aacacgggccggtatccagatgtcatcagccgcatcccgaagatgaagcatccctcagtc
atctcctgcattctggacgcagaagctgtggcctgggaccgggtaaagaagcaaattcag
cccttccaggtgctcagcacacgcaaacgcaaggaggtggaggaggccgagatccaagtc
caggtgtgcctgtatgccttcgacctcatctacctcaatgggcagtccctggtccgggag
ccgctgtcccggaggcggcagcagctccgggagaacttcatcgagacagagggcgagttt
gtttttgccacgtctctagacacgaaggacactgagcagatcgccgacttcctggagcag
tccgtgaaagattcctgtgagggcctgatggtgaagacccttgacaccaacgccacctat
gagattgccaagagatcccacaactggctcaagctgaagaaggattatctggaaggcatt
ggggacactctggacctggtgttgatcggggcctatttgggccgggggaaacgggccgga
cgatacgggggctttctcctggctgccttcgatgaggacagtgaagagttccaggctatt
tgcaagctgggcacaggcttcagtgatgaagaattagaggaacattaccagagcctccag
gccctcgtgatccctgctcctcgttcctatgtccgagccgaaggggctgtaccccctgac
cactggctagaaccaaccactgtatgggaggttaaatgtgctgatctctctgtctcccca
atttattcggcagcccgagggttggtggagagcgacaagggcgtctccctgcggtttccc
cgatttgtccaagttcgaaaagacaagaaaccagaagaggcaacctccagtgcccaggtg
gccaatttgtataagaaacagcaacagattcagaaccagcaggattccaaatcccctacc
tttgaaccggaagatttctgttaa

DBGET integrated database retrieval system