KEGG   Phascolarctos cinereus (koala): 110220610
Entry
110220610         CDS       T05867                                 

Gene name
MAX
Definition
(RefSeq) protein max isoform X1
  KO
K04453  Max protein
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw05200  Pathways in cancer
pcw05202  Transcriptional misregulation in cancer
pcw05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110220610 (MAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110220610 (MAX)
   05202 Transcriptional misregulation in cancer
    110220610 (MAX)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110220610 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcw03000]
    110220610 (MAX)
Transcription factors [BR:pcw03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    110220610 (MAX)
SSDB
Motif
Pfam: HLH Jnk-SapK_ap_N bZIP_2 DUF5716 SlyX DUF5595 YebO ZapB SLX9 Csm1_N V_ATPase_I
Other DBs
NCBI-GeneID: 110220610
NCBI-ProteinID: XP_020860328
UniProt: A0A6P5LT18
LinkDB
Position
Unknown
AA seq 162 aa
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKQQA
SRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYASS
DNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcagccgaggtttcaatct
gcggctgacaaacgagcgcatcataatgcactggagcgaaagcgcagggaccacatcaaa
gatagctttcacagtttgcgggactctgtcccatcactccaaggagagaagcaacaggca
tcccgggcccaaatcttagataaagccacagagtacatccagtatatgagaaggaaaaac
cacacacaccagcaggatattgatgacctcaagcggcagaacgctctactggagcagcaa
gtccgtgcactggagaaagcgaggtcaagcgcccaactgcagaccaactatgcttcttcg
gacaacagcctctacaccaatgccaagggcagcaccatctctgccttcgacgggggctca
gattccagctctgagtcagagcctgaagagccccagagccgaaagaaactccggatggag
gccagctag

DBGET integrated database retrieval system