KEGG   Phascolarctos cinereus (koala): 110220894
Entry
110220894         CDS       T05867                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw04010  MAPK signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04390  Hippo signaling pathway
pcw04810  Regulation of actin cytoskeleton
pcw05200  Pathways in cancer
pcw05218  Melanoma
pcw05224  Breast cancer
pcw05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110220894 (FGF1)
   04014 Ras signaling pathway
    110220894 (FGF1)
   04015 Rap1 signaling pathway
    110220894 (FGF1)
   04390 Hippo signaling pathway
    110220894 (FGF1)
   04151 PI3K-Akt signaling pathway
    110220894 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110220894 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110220894 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    110220894 (FGF1)
   05218 Melanoma
    110220894 (FGF1)
   05224 Breast cancer
    110220894 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcw04052]
    110220894 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pcw00536]
    110220894 (FGF1)
Cytokines and growth factors [BR:pcw04052]
 Growth factors
  Growth factors (RTK binding)
   110220894 (FGF1)
Glycosaminoglycan binding proteins [BR:pcw00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110220894 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110220894
NCBI-ProteinID: XP_020860802
LinkDB
Position
Unknown
AA seq 153 aa
MAEGEITTFTALTERFNLPLANYKKPKLLYCSNGGHFLRILPDGKVDGTRDRNDQHIQLQ
LSAESVGEVYIKSTESGQYLAMDTDGLLYGSQTPSEECLFLERLEENHYNTYVSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLSSE
NT seq 462 nt   +upstreamnt  +downstreamnt
atggccgaaggggagatcacaaccttcacagccctgaccgaaagatttaacctgccgcta
gcgaattacaagaagcccaagcttctctactgtagcaacgggggccactttttgaggatc
cttcctgatggcaaagtggatgggacaagggacagaaatgatcaacacattcaactgcaa
ctaagcgcggaaagcgtgggtgaggtgtatataaagagcactgagtctggccagtatttg
gctatggacaccgatggacttttatacggctcacagacacccagcgaagaatgcttgttc
ctggagaggttggaggagaatcattacaacacctacgtatcgaagaagcatgcggaaaaa
aattggtttgttggcctcaagaagaatggaagctgcaaaagaggtcccaggactcactat
ggccagaaagccatcctgtttcttcccctctcatctgagtaa

DBGET integrated database retrieval system